IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. The Journal of biological chemistry 2009 imex curation Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Dark space = 36? Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down elisa enzyme linked immunosorbent assay ELISA ELISA elisa Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk Accepted 2016-JUL-27 AT 14:55 BST AT 14:55 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation comment added. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. The Journal of biological chemistry 2009 imex curation Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Dark space = 36? Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk Accepted 2016-JUL-27 AT 14:55 BST AT 14:55 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation comment added. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. The Journal of biological chemistry 2009 imex curation Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Dark space = 36? Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk Accepted 2016-JUL-27 AT 14:55 BST AT 14:55 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation comment added. Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. The Journal of biological chemistry 2009 imex curation Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Dark space = 36? Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk Accepted 2016-JUL-27 AT 14:55 BST AT 14:55 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation comment added. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition. The Journal of biological chemistry 2009 imex curation Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Dark space = 36? Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Ma YJ., Doni A., Hummelshøj T., Honoré C., Bastone A., Mantovani A., Thielens NM., Garred P. Fig 2 not included - as mols in "medium" - no purification. Recombinant PTX3 is of Human origin - see pmid:9407058 (via Ref 25) garred@post5.tele.dk Accepted 2016-JUL-27 AT 14:55 BST AT 14:55 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation comment added. mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI DIP protein P11226 original sequence version: 181 C1F2AAED46D0F774 c1qc_human Complement C1q subcomponent subunit C C1QC C1QG protein protein human Homo sapiens Human MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD FA17117EB7ABFC12 ptx3_human Pentraxin-related protein PTX3 Pentaxin-related protein PTX3 TNFAIP5 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein PTX3 protein protein human Homo sapiens Human MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS 09BCE02E2A62D62A fcn1_human Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 184D24B371B251AB fcn3_human Ficolin-3 FCN3 FCNH HAKA1 Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen protein protein human Homo sapiens Human MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR 5CB8A7D3668FA364 fcn2_human Ficolin-2 FCN2 FCNL Ficolin-B Ficolin-beta L-ficolin Collagen/fibrinogen domain-containing protein 2 Serum lectin p35 37 kDa elastin-binding protein EBP-37 Hucolin protein protein human Homo sapiens Human MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA mint Calcium-dependent and GlcNAc-binding lectin. Enhanced phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region D363029846CCB3C9 n-acetyl-d-glucosamine N-acetyl-D-glucosamine 2-Acetamido-2-deoxy-D-glucose GlcNAc N-Acetyl-D-glucosamine N-acetyl-D-glucosamine N-Acetylchitosamine 2-acetamido-2-deoxy-D-glucopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) prop_human Properdin CFP PFC Complement factor P protein protein human Homo sapiens Human MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL 5EB42B63F0283917 c1qa_human Complement C1q subcomponent subunit A C1QA protein protein human Homo sapiens Human MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA DIP protein P02745 original sequence version: null 8FF6B6AE02D49C4C cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE c1qb_human Complement C1q subcomponent subunit B C1QB protein protein human Homo sapiens Human MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA D80C753C0D430EDC 2354rwr-1 2 12 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 21 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 14 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 16 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. association association none- text only MASPs and several other proteins were detected, whose identity is not stated. ptx3-c1q_human-4 5 12 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 21 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. association association Figure 1 A/B ptx3-c1q_human-5 5 12 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 21 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 7 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. association association Figure 1 C/D 3634-1 6 10 unspecified role unspecified role prey prey crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 3A, 4A, 5A, 7A Calcium chelation increased binding of both Ficolin-1 and Ficolin-2 to PTX3. ptx3-fcn1-8 6 12 unspecified role unspecified role prey prey Q15485:p.Thr236Met mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T M Wed May 02 15:43:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr236met' Tue Jun 30 19:51:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr236Met' crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 3B, 4B, 5B, 7B, 11C Calcium chelation increased binding of both Ficolin-1 and Ficolin-2 to PTX3. ptx3-fcn2-2 6 11 unspecified role unspecified role prey prey crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 3C, 4C, 7A CHEBI:506227 causes no change to binding of O75636 to P26022 Serum derived Ficolin-3 presented no binding as compared to the slight binding of recombinant Ficolin-3. fcn1-ptx3-3 6 13 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 3A, 4A, 5Ai CHEBI:506227 decreased the binding of O00602 to P26022 ptx3-fcn2-3 6 12 unspecified role unspecified role prey prey crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 13 inhibitor inhibitor unspecified role unspecified role 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 3B, 4B, 5Bi CHEBI:506227 decreased the binding of Q15485 to P26022 fcn1-ptx3-4 3 12 unspecified role unspecified role prey prey crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 6 is stoichiometry meant to be 4:1 for ficolin/Ptx3? - not sure so have not entered. Calcium chelation by EDTA appeared to increase the stability of the complex. ptx3-fcn1-9 6 10 unspecified role unspecified role prey prey human-serum Homo sapiens serum Serum 9 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 7A ptx3-fcn1-10 6 12 unspecified role unspecified role prey prey crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 9 unspecified role unspecified role bait bait human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast direct interaction direct interaction 7B n_acetyl_d_glucosamine-fcn2-1 1 12 unspecified role unspecified role prey prey Q15485:p.Thr236Met mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T M Wed May 02 16:33:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr236met' Tue Jun 30 19:00:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr236Met' crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 13 unspecified role unspecified role bait bait direct interaction direct interaction 11B c1q_human Complement component C1q complex C1q Complement 1q C1QA-C1QB-C1QC complex 6xC1QA:6xC1QB:6xC1QC 17 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 71 65 66 72 68 75 69 69 90 84 75 111 90 78 74 81 108 84 77 80 99 83 87 111 108 86 98 92 96 89 93 95 101 104 105 107 102 114 110 117 113 116 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Complement component C1q deficiency (C1QD) [MONDO:0013343]: a disorder caused by impaired activation of the complement classical pathway. It generally leads to severe immune complex disease with features of systemic lupus erythematosus and glomerulonephritis. coronavirus The complex comprises of six heterotrimeric collagen-like triple helices, formed from triplets of the A, B, and C chains, that associate in their N-terminal half to form a stalk, then diverge to form individual stems, each terminating in a C-terminal globular domain. Each of the six heterotrimeric globular heads or domains is made up of the globular domains from one A, one B, and one C chain, each of which in turn has its own ligand specificity. The six collagen-like stalks appear to be fibril-like and exist in the central region. The collagen-like region and the globular heads can independently interact with a multiplicity of biological structures including pathogen-associated and cell associated molecules, also each of the individual globular head domains is capable of independently interacting with specific ligands. Chains A and B are disulfide-linked whilst the C chain forms a disulfide bond with the C chain of the next strand. Molecular weight 460 kDa. Recognition unit of the classical pathway of complement which associates with the Ca2+ - dependent C1r(2)-C1s(2) tetramer to form C1 (CPX-1920), the first component of the classical complement system. The complex's role in C1 is the recognition of immune complexes, or other molecules, which trigger the classical pathway of the complement system. Independent of complement activation C1q appears to have additional roles in homeostasis and cellular development, superoxide (O2-) production by neutrophils, blood coagulation and neurological synapse pruning. Heterooctadecamer created with intact-jami-dbscripts