IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Nature structural & molecular biology 2009 imex curation Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com Accepted 2016-APR-05 AT 12:00 BST AT 12:00 BST by ORCHARD Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation I think you are right - I have added a His tag to HHIP and removed it from SHH - I thought the "Cloning and expression" (of SHH) stated the Flag tagged SHH construct also had a his-tag, but on looking again, quite possibly not. I think the "method" is the "Peptide competition ELISA" which uses an anti-his-HRP conjugate to detect binding- presumably of HHIP. I dont see how we can link domains - as the domain interacting is not known for HHIP and the construct used is >half the length of the protein. ; added; done; Altered all The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Nature structural & molecular biology 2009 imex curation Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com Accepted 2016-APR-05 AT 12:00 BST AT 12:00 BST by ORCHARD Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation I think you are right - I have added a His tag to HHIP and removed it from SHH - I thought the "Cloning and expression" (of SHH) stated the Flag tagged SHH construct also had a his-tag, but on looking again, quite possibly not. I think the "method" is the "Peptide competition ELISA" which uses an anti-his-HRP conjugate to detect binding- presumably of HHIP. I dont see how we can link domains - as the domain interacting is not known for HHIP and the construct used is >half the length of the protein. ; added; done; Altered all The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Nature structural & molecular biology 2009 imex curation Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com Accepted 2016-APR-05 AT 12:00 BST AT 12:00 BST by ORCHARD Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation I think you are right - I have added a His tag to HHIP and removed it from SHH - I thought the "Cloning and expression" (of SHH) stated the Flag tagged SHH construct also had a his-tag, but on looking again, quite possibly not. I think the "method" is the "Peptide competition ELISA" which uses an anti-his-HRP conjugate to detect binding- presumably of HHIP. I dont see how we can link domains - as the domain interacting is not known for HHIP and the construct used is >half the length of the protein. ; added; done; Altered all The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Nature structural & molecular biology 2009 imex curation Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? Plates were coated with HHIP and dilutions of either DHH, IHH or SHH plus biotinylated-SHH were added. Streptavidin-HRP was added, wells washed, HRP substrate added and colour/OD measured. sauvage@gene.com,hymowitz@gene.com,laz@gene.com Accepted 2016-APR-05 AT 12:00 BST AT 12:00 BST by ORCHARD Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation I think you are right - I have added a His tag to HHIP and removed it from SHH - I thought the "Cloning and expression" (of SHH) stated the Flag tagged SHH construct also had a his-tag, but on looking again, quite possibly not. I think the "method" is the "Peptide competition ELISA" which uses an anti-his-HRP conjugate to detect binding- presumably of HHIP. I dont see how we can link domains - as the domain interacting is not known for HHIP and the construct used is >half the length of the protein. ; added; done; Altered all The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling. Nature structural & molecular biology 2009 imex curation Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Dark Space Dataset no 4? sauvage@gene.com,hymowitz@gene.com,laz@gene.com Accepted 2016-APR-05 AT 12:00 BST AT 12:00 BST by ORCHARD Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation I think you are right - I have added a His tag to HHIP and removed it from SHH - I thought the "Cloning and expression" (of SHH) stated the Flag tagged SHH construct also had a his-tag, but on looking again, quite possibly not. I think the "method" is the "Peptide competition ELISA" which uses an anti-his-HRP conjugate to detect binding- presumably of HHIP. I dont see how we can link domains - as the domain interacting is not known for HHIP and the construct used is >half the length of the protein. ; added; done; Altered all calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dhh_human Desert hedgehog protein HHG-3 DHH protein protein human Homo sapiens Human MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG DIP protein O43323 original sequence version: 100 FCE4FB21972C3AD5 ptc1_human Protein patched homolog 1 PTCH1 PTCH protein protein human Homo sapiens Human MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEERPRGSSSN DIP protein Q13635 original sequence version: 109 F2937247BC812F85 zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) shh_human Sonic hedgehog protein Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains SHH HHG-1 protein protein human Homo sapiens Human MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGAADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS DIP protein Q15465 original sequence version: 187 DD687AFA582A4749 hhip_human Hedgehog-interacting protein HHIP HIP UNQ5825/PRO19644 protein protein human Homo sapiens Human MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV CC1CB3435E29303A ihh_human Indian hedgehog protein IHH HHG-2 protein protein human Homo sapiens Human MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS 4DA90C83F5ABF758 hhip-shh-1 1 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 cofactor cofactor coenzyme neutral component neutral component 11 unspecified role unspecified role neutral component neutral component beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 19 direct interaction direct interaction Table 1 3.0A R work 0.231 R Free 0.287 shh-hhip-1 3 10 unspecified role unspecified role bait bait zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey beta_propeller_and_egf_domain_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 23 26 direct interaction direct interaction 3C shh-hhip-2 3 11 competitor competitor competitor unspecified role unspecified role region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey beta_propeller_and_egf_domain_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction 3Ci shh-hhip-5 2 10 unspecified role unspecified role neutral component neutral component zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q96QV1:p.[Asp371Cys;Thr389Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain T C certain certain sequence position certain certain certain sequence position certain D C Wed May 02 18:02:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp371cys,thr389cys' Tue Jun 30 19:09:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp371Cys;Thr389Cys]' 39 42 direct interaction direct interaction 4C shh-hhip-3 2 8 unspecified role unspecified role neutral component neutral component region_l2_like_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q13635:p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly] mutation mutation certain certain sequence position certain certain certain sequence position certain IS GC certain certain sequence position certain certain certain sequence position certain SA CG Fri Jul 22 10:58:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile899gly,ser900cys,ser917cys,ala918gly' Wed May 02 17:52:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile_ser899-900gly_cys,ser_ala917-918cys_gly' Tue Jun 30 17:51:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly]' 10 unspecified role unspecified role neutral component neutral component region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 50 46 direct interaction direct interaction 4D ptch1-shh-1 2 10 unspecified role unspecified role neutral component neutral component region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 competitor competitor competitor neutral component neutral component region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q96QV1:p.[Asp371Cys;Thr389Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain D C certain certain sequence position certain certain certain sequence position certain T C Wed May 02 14:24:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp371cys,thr389cys' Tue Jun 30 16:50:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp371Cys;Thr389Cys]' 8 unspecified role unspecified role neutral component neutral component region_l2_like_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q13635:p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly] mutation mutation certain certain sequence position certain certain certain sequence position certain IS GC certain certain sequence position certain certain certain sequence position certain SA CG Fri Jul 22 11:15:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile899gly,ser900cys,ser917cys,ala918gly' Wed May 02 19:29:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile_ser899-900gly_cys,ser_ala917-918cys_gly' Tue Jun 30 17:18:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly]' 54 59 54 57 physical association physical association 4E shh-hhip-4 4 10 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 68 64 direct interaction direct interaction Supp 7B Antibody "5E1" (a high-affinity anti-Shh monoclonal antibody) competes for SHH binding hhip-shh-2 4 11 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 competitor competitor competitor prey prey zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1Ai hhip-shh-3 4 11 unspecified role unspecified role bait bait beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 competitor competitor competitor prey prey zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1Aii hhip-dhh-1 4 11 unspecified role unspecified role bait bait beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 competitor competitor competitor prey prey zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1Aiii hhip-shh-4 5 11 unspecified role unspecified role bait bait beta_propeller_and_egf_domain_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 104 107 direct interaction direct interaction Supp 4 EDTA hhip-shh-5 2 10 unspecified role unspecified role neutral component neutral component zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q96QV1:p.[Asp371Cys;Thr389Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain T C certain certain sequence position certain certain certain sequence position certain D C Wed May 02 16:43:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp371cys,thr389cys' Tue Jun 30 17:44:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp371Cys;Thr389Cys]' 111 114 direct interaction direct interaction Supp 6A ptch1-shh-2 2 8 unspecified role unspecified role neutral component neutral component region_l2_like_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q13635:p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly] mutation mutation certain certain sequence position certain certain certain sequence position certain IS GC certain certain sequence position certain certain certain sequence position certain SA CG Fri Jul 22 11:12:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile899gly,ser900cys,ser917cys,ala918gly' Wed May 02 17:56:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile_ser899-900gly_cys,ser_ala917-918cys_gly' Tue Jun 30 17:37:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly]' 10 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 122 118 direct interaction direct interaction Supp 6A