UniProt UniProt http://www.uniprot.org Identification of a new functional domain in angiopoietin-like 3 (ANGPTL3) and angiopoietin-like 4 (ANGPTL4) involved in binding and inhibition of lipoprotein lipase (LPL). Identification of a new functional domain in angiopoietin-like 3 (ANGPTL3) and angiopoietin-like 4 (ANGPTL4) involved in binding and inhibition of lipoprotein lipase (LPL). The Journal of biological chemistry 2009 imex curation Lee EC., Desai U., Gololobov G., Hong S., Feng X., Yu XC., Gay J., Wilganowski N., Gao C., Du LL., Chen J., Hu Y., Zhao S., Kirkpatrick L., Schneider M., Zambrowicz BP., Landes G., Powell DR., Sonnenburg WK. wsonnenburg@lexpharma.com 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Lee EC., Desai U., Gololobov G., Hong S., Feng X., Yu XC., Gay J., Wilganowski N., Gao C., Du LL., Chen J., Hu Y., Zhao S., Kirkpatrick L., Schneider M., Zambrowicz BP., Landes G., Powell DR., Sonnenburg WK. wsonnenburg@lexpharma.com Accepted 2016-FEB-15 AT 09:59 GMT AT 09:59 GMT by ORCHARD The Journal of biological chemistry 2009 imex curation Identification of a new functional domain in angiopoietin-like 3 (ANGPTL3) and angiopoietin-like 4 (ANGPTL4) involved in binding and inhibition of lipoprotein lipase (LPL). Identification of a new functional domain in angiopoietin-like 3 (ANGPTL3) and angiopoietin-like 4 (ANGPTL4) involved in binding and inhibition of lipoprotein lipase (LPL). The Journal of biological chemistry 2009 imex curation Lee EC., Desai U., Gololobov G., Hong S., Feng X., Yu XC., Gay J., Wilganowski N., Gao C., Du LL., Chen J., Hu Y., Zhao S., Kirkpatrick L., Schneider M., Zambrowicz BP., Landes G., Powell DR., Sonnenburg WK. wsonnenburg@lexpharma.com 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro lipase assay lipase assay predetermined predetermined participant predetermined Lee EC., Desai U., Gololobov G., Hong S., Feng X., Yu XC., Gay J., Wilganowski N., Gao C., Du LL., Chen J., Hu Y., Zhao S., Kirkpatrick L., Schneider M., Zambrowicz BP., Landes G., Powell DR., Sonnenburg WK. wsonnenburg@lexpharma.com Accepted 2016-FEB-15 AT 09:59 GMT AT 09:59 GMT by ORCHARD The Journal of biological chemistry 2009 imex curation lipl_human Lipoprotein lipase LPL LIPD Phospholipase A1 protein protein human Homo sapiens Human MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG FBD00FCD334FB8AA 1,2-di-o-lauryl-rac-glycero-3-glutaric acid 6'-methylresorufin ester 1,2-di-O-lauryl-rac-glycero-3-glutaric acid 6'-methylresorufin ester 1,2-di-O-dodecyl-rac-glycero-3-glutaric acid 6'-methylresorufin ester DGGR 1-[2,3-bis(dodecyloxy)propyl] 6-methyl-3-oxo-3H-phenoxazin-7-yl pentanedioate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) angl4_human Angiopoietin-related protein 4 ANGPTL4 ARP4 HFARP PGAR Angiopoietin-like protein 4 Hepatic fibrinogen/angiopoietin-related protein PP1158 PSEC0166 UNQ171/PRO197 protein protein human Homo sapiens Human MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS 219E56FEB3F602AF angl3_human Angiopoietin-related protein 3 ANGPTL3 ANGPT5 UNQ153/PRO179 Angiopoietin-like protein 3 Angiopoietin-5 protein protein human Homo sapiens Human MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE 6279465FEEB91F56 angptl4-lpl-3 1 3 unspecified role unspecified role prey prey c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain antibody aginst this epitope decreases association region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2, S4e, f angptl3-lpl-2 1 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range Epitope-specific antibody impairs association region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 6 1,2_di_o_lauryl_rac_glycero_3_glutaric acid 6'_methylresorufin ester-angptl3-1 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role 3 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 inhibitor inhibitor unspecified role unspecified role c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction 5a and b ANGPTL3 inhibits LPL activity by approximat. 50%. Addition of epitope-specific antibody prevented inhibition by ANGPTL3 with an Ec of 22 nM. 1,2_di_o_lauryl_rac_glycero_3_glutaric acid 6'_methylresorufin ester-lpl-1 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role 3 enzyme enzyme unspecified role unspecified role c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 5a