HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Analysis of the herpesvirus chemokine-binding glycoprotein G residues essential for chemokine binding and biological activity. Analysis of the herpesvirus chemokine-binding glycoprotein G residues essential for chemokine binding and biological activity. The Journal of biological chemistry 2009 imex curation Van de Walle GR., Kaufer BB., Chbab N., Osterrieder N. Virus - Publications including interactions involving viral proteins no34@cornell.edu, no.34@fu-berlin.de 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa tag visualisation tag visualisation Van de Walle GR., Kaufer BB., Chbab N., Osterrieder N. Virus - Publications including interactions involving viral proteins From reference 20, EHV-1 wild-type strain RacL11 is used no34@cornell.edu, no.34@fu-berlin.de Accepted 2016-MAY-19 AT 08:30 BST AT 08:30 BST by ORCHARD The Journal of biological chemistry 2009 imex curation gg_ehv1b Envelope glycoprotein G gG 70 protein protein EHV-1 Equine herpesvirus 1 (strain Ab4p) Equine abortion virus MLTVLAALSLLSLLTSATGRLAPDELCYAEPRRTGSPPNTQPERPPVIFEPPTIAIKAESKGCELILLDPPIDVSYRREDKVNASIAWFFDFGACRMPIAYREYYGCIGNAVPSPETCDAYSFTLIRTEGIVEFTIVNMSLLFQPGIYDSGNFIYSVLLDYHIFTGRVTLEVEKDTNYPCGMIHGLTAYGNINVDETMDNASPHPRAVGCFPEPIDNEAWANVTFTELGIPDPNSFLDDEGDYPNISDCHSWESYTYPNTLRQATGPQTLLVGAVGLRILAQAWKFVGDETYDTIRAEAKNLETHVPSSAAESSLENQSTQEESNSPEVAHLRSVNSDDSTHTGGASNGIQDCDSQLKTVYACLALIGLGTCAMIGLIVYICVLRSKLSSRNFSRAQNVKHRNYQRLEYVA CC6349C38D0E12E2 il8_horse Interleukin-8 CXCL8 IL8 C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 protein protein horse Equus caballus (Horse) Horse MTSKLAVALLAVFLLSAALCEAAVVSRITAELRCQCIKTHSKPFNPKLIKEMRAIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP E34878111854009A gg-il2-1 1 2 unspecified role unspecified role prey prey purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3B,4B and 6A cxcl8-gg-1 1 2 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3B cxcl8-gg-2 1 2 competitor competitor competitor prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 2 unspecified role unspecified role prey prey purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 7