UniProt UniProt http://www.uniprot.org The angiopoietin-like proteins ANGPTL3 and ANGPTL4 inhibit lipoprotein lipase activity through distinct mechanisms. The angiopoietin-like proteins ANGPTL3 and ANGPTL4 inhibit lipoprotein lipase activity through distinct mechanisms. The Journal of biological chemistry 2009 imex curation Shan L., Yu XC., Liu Z., Hu Y., Sturgis LT., Miranda ML., Liu Q. lshan@lexpharma.com 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shan L., Yu XC., Liu Z., Hu Y., Sturgis LT., Miranda ML., Liu Q. lshan@lexpharma.com Ishan@lexpharma.com Accepted 2016-FEB-15 AT 10:00 GMT AT 10:00 GMT by ORCHARD The Journal of biological chemistry 2009 imex curation The angiopoietin-like proteins ANGPTL3 and ANGPTL4 inhibit lipoprotein lipase activity through distinct mechanisms. The angiopoietin-like proteins ANGPTL3 and ANGPTL4 inhibit lipoprotein lipase activity through distinct mechanisms. The Journal of biological chemistry 2009 imex curation Shan L., Yu XC., Liu Z., Hu Y., Sturgis LT., Miranda ML., Liu Q. lshan@lexpharma.com 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro lipase assay lipase assay predetermined predetermined participant predetermined Shan L., Yu XC., Liu Z., Hu Y., Sturgis LT., Miranda ML., Liu Q. lshan@lexpharma.com Ishan@lexpharma.com Accepted 2016-FEB-15 AT 10:00 GMT AT 10:00 GMT by ORCHARD The Journal of biological chemistry 2009 imex curation 1,2-di-o-lauryl-rac-glycero-3-glutaric acid 6'-methylresorufin ester 1,2-di-O-lauryl-rac-glycero-3-glutaric acid 6'-methylresorufin ester 1,2-di-O-dodecyl-rac-glycero-3-glutaric acid 6'-methylresorufin ester DGGR 1-[2,3-bis(dodecyloxy)propyl] 6-methyl-3-oxo-3H-phenoxazin-7-yl pentanedioate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) angl3_human Angiopoietin-related protein 3 ANGPTL3 ANGPT5 UNQ153/PRO179 Angiopoietin-like protein 3 Angiopoietin-5 protein protein human Homo sapiens Human MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE 6279465FEEB91F56 angl4_human Angiopoietin-related protein 4 ANGPTL4 ARP4 HFARP PGAR Angiopoietin-like protein 4 Hepatic fibrinogen/angiopoietin-related protein PP1158 PSEC0166 UNQ171/PRO197 protein protein human Homo sapiens Human MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS 219E56FEB3F602AF lipl_human Lipoprotein lipase LPL LIPD Phospholipase A1 protein protein human Homo sapiens Human MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG FBD00FCD334FB8AA angptl3-lpl-1 2 6 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 enzyme target enzyme target substrate substrate unspecified role unspecified role lipid cleavage lipid cleavage 1B aand 2B Heparin can neutralize the inhibitory effect of ANGPTL3 on LPL activity angptl4-lpl-1 2 5 inhibitor inhibitor unspecified role unspecified role Q9BY76:p.Glu40Lys mutation mutation certain certain sequence position certain certain certain sequence position certain E K Wed May 02 18:56:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu40lys' Tue Jun 30 19:44:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu40Lys' n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 enzyme target enzyme target substrate substrate unspecified role unspecified role lipid cleavage lipid cleavage 1A , 2A and 3A Heparin cannot neutralize the inhibitory effect of ANGPTL4 on LPL activity. The glu40lys point mutation caused a significant loss of the inactivating effects of ANGPTL4 on LPL. angptl4-lpl-2 2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role 5 inhibitor inhibitor unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BY76:p.[Cys76Ser;Cys80Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 20:08:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys76ser,cys80ser' Tue Jun 30 17:39:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys76Ser;Cys80Ser]' ecoli Escherichia coli (strain K12) 6 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. lipid cleavage lipid cleavage 1C Effect on LPL activity of ANGPTL4 mutant is comparable to that of wildtype ANGPTL4 angptl4-1 1 5 unspecified role unspecified role unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3D angptl4-3 1 5 unspecified role unspecified role unspecified role unspecified role n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9BY76:p.[Cys76Ser;Cys80Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:58:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys76ser,cys80ser' Tue Jun 30 17:10:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys76Ser;Cys80Ser]' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3D angptl4-5 1 5 unspecified role unspecified role unspecified role unspecified role Q9BY76:p.[Cys76Ser;Cys80Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:49:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys76ser,cys80ser' Tue Jun 30 15:41:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys76Ser;Cys80Ser]' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3D 1,2_di_o_lauryl_rac_glycero_3_glutaric acid 6'_methylresorufin ester-lpl-2 2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme enzyme unspecified role unspecified role c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. lipid cleavage lipid cleavage 1 and 2