IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. The Journal of biological chemistry 2007 imex curation Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-retina Mus musculus retina retina retinal tissue fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca Accepted 2016-MAY-23 AT 08:51 BST AT 08:51 BST by ORCHARD The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation I think these are OK now; there were extra (computationally added) multiple different XRefs added to the internally created proteins. I have deleted most-the only one left is "xlrs1_bovin" and I have added a "see also" UniProt Xref for Bos mutus (wild yak) identifier in attempt to stop this happening again. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. The Journal of biological chemistry 2007 imex curation Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation bovin-retina Bovine retina retina retinal tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Solubilised bovine retina membranes Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca Accepted 2016-MAY-23 AT 08:51 BST AT 08:51 BST by ORCHARD The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation I think these are OK now; there were extra (computationally added) multiple different XRefs added to the internally created proteins. I have deleted most-the only one left is "xlrs1_bovin" and I have added a "see also" UniProt Xref for Bos mutus (wild yak) identifier in attempt to stop this happening again. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. The Journal of biological chemistry 2007 imex curation Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-retina Human retina cells retina retinal tissue anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Solubilized membrane extracts from human retina Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca Accepted 2016-MAY-23 AT 08:51 BST AT 08:51 BST by ORCHARD The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation I think these are OK now; there were extra (computationally added) multiple different XRefs added to the internally created proteins. I have deleted most-the only one left is "xlrs1_bovin" and I have added a "see also" UniProt Xref for Bos mutus (wild yak) identifier in attempt to stop this happening again. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. The Journal of biological chemistry 2007 imex curation Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. possibly the activated Factor 5a should be a complex - but the formation of the complex requires Calcium, which is present here, but not sure if this should be included here - so have not asked for a complex to be created. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca Accepted 2016-MAY-23 AT 08:51 BST AT 08:51 BST by ORCHARD The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation I think these are OK now; there were extra (computationally added) multiple different XRefs added to the internally created proteins. I have deleted most-the only one left is "xlrs1_bovin" and I have added a "see also" UniProt Xref for Bos mutus (wild yak) identifier in attempt to stop this happening again. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. The Journal of biological chemistry 2007 imex curation Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-retina Mus musculus retina retina retinal tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca Accepted 2016-MAY-23 AT 08:51 BST AT 08:51 BST by ORCHARD The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation I think these are OK now; there were extra (computationally added) multiple different XRefs added to the internally created proteins. I have deleted most-the only one left is "xlrs1_bovin" and I have added a "see also" UniProt Xref for Bos mutus (wild yak) identifier in attempt to stop this happening again. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. The Journal of biological chemistry 2007 imex curation Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro liposome binding assay liposome binding assay western blot western blot Immuno blot Immuno blot Molday LL., Wu WW., Molday RS., Molday LL., Wu WW., Molday RS. Dark Space = ?25 Factor 5 has been confirmed to be of Human origin by the authors. molday@interchange.ubc.ca Accepted 2016-MAY-23 AT 08:51 BST AT 08:51 BST by ORCHARD The Journal of biological chemistry 2007 Only protein-protein interactions imex curation imex curation I think these are OK now; there were extra (computationally added) multiple different XRefs added to the internally created proteins. I have deleted most-the only one left is "xlrs1_bovin" and I have added a "see also" UniProt Xref for Bos mutus (wild yak) identifier in attempt to stop this happening again. xlrs1_mouse Retinoschisin Rs1 Rs1h Xlrs1 X-linked juvenile retinoschisis protein homolog protein protein mouse Mus musculus Mouse MPHKIEGFFLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQVGANALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKYQDSSQWLQIDLKEIKVISGILTQGRCDIDEWVTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRSSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECASKCA 4536203CC00E90E4 sarm1_human NAD(+) hydrolase SARM1 Sterile alpha and Armadillo repeat protein Sterile alpha motif domain-containing protein 2 Tir-1 homolog SARM1 KIAA0524 SAMD2 SARM NADP(+) hydrolase SARM1 Sterile alpha and TIR motif-containing protein 1 protein protein human Homo sapiens Human MVLTLLLSAYKLCRFFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTEVQDALERALPELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT 6391EA4C31EF6604 at1b2_bovin Sodium/potassium-transporting ATPase subunit beta-2 ATP1B2 Sodium/potassium-dependent ATPase subunit beta-2 protein protein bovin Bos taurus (Bovine) Bovine MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVISFYAGANQSMNVTCVGKRDEDAENLGNFVMFPANGNIDLIYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAPRVAFKLRINKT 5B21764A0DFB0B86 f1mps1_bovin RS1 protein protein bovin Bos taurus (Bovine) Bovine FPHHLYGIYTLTMDEGEDPWYHKACKCDCQGGANALWSAGPTPLDCIPECPYHKPLGFESGEVTPDQITCSNVEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEVKVISGILTQGRCDIDEWMTKYSVQYRTDESLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCT 7DBAFC78FE6B555D p12259-pro_0000002981 Coagulation factor V light chain Activated protein C cofactor Proaccelerin, labile factor F5 protein protein human Homo sapiens Human SNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTTYKKVVFRKYLDSTFTKRDPRGEYEEHLGILGPIIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEGKTYEDDSPEWFKEDNAVQPNSSYTYVWHATERSGPESPGSACRAWAYYSAVNPEKDIHSGLIGPLLICQKGILHKDSNMPMDMREFVLLFMTFDEKKSWYYEKKSRSSWRLTSSEMKKSHEFHAINGMIYSLPGLKMYEQEWVRLHLLNIGGSQDIHVVHFHGQTLLENGNKQHQLGVWPLLPGSFKTLEMKASKPGWWLLNTEVGENQRAGMQTPFLIMDRDCRMPMGLSTGIISDSQIKASEFLGYWEPRLARLNNGGSYNAWSVEKLAAEFASKPWIQVDMQKEVIITGIQTQGAKHYLKSCYTTEFYVAYSSNQINWQIFKGNSTRNVMYFNGNSDASTIKENQFDPPIVARYIRISPTRAYNRPTLRLELQGCEVNGCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSIALRLELFGCDIY 1574 2224 0311B0A37F82F197 1,2-dioleoyl-sn-glycero-3-phosphocholine 1,2-dioleoyl-sn-glycero-3-phosphocholine (R-(Z,Z))-(7-Oleoyl-4-oxido-10-oxo-3,5,9-trioxa-4-phosphaheptacos-18-enyl)trimethylammonium 4-oxide 1,2-di-(9Z)-octadecenoyl-sn-glycero-3-phosphocholine 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine 1,2-dioleoyl-L-alpha-lecithin 1-(9Z)-octadecenoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphocholine 1-C18:1(omega-9)-2-C18:1(omega-9)-phosphatidylcholine Dioleoyl lecithin Dioleoyl phosphatidylcholine PC(18:1(9Z)/18:1(9Z)) PC(18:1/18:1) (2R)-2,3-bis[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylazaniumyl)ethyl phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) at1b2_human Sodium/potassium-transporting ATPase subunit beta-2 ATP1B2 Adhesion molecule in glia Sodium/potassium-dependent ATPase subunit beta-2 protein protein human Homo sapiens Human MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT CC5BFBB6D01347F1 e1bir9_bovin NAD(+) hydrolase SARM1 SARM1 NADP(+) hydrolase SARM1 Sterile alpha and TIR motif-containing protein 1 protein protein bovin Bos taurus (Bovine) Bovine MVLTLLLSAYKLCRFFAMSGPRPDAERLAVPGPDGGGGASQWWVAGSRRPRELSPGASTEVQGALERALPELQQALSALKQAVSVRALGAGLTEVFQLVEEAWLLPAMGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQKLVTAGGLDAVLYWCRRTDQALLRHCALALANCALHGGQAAQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLDLVEPLVASLDPGRFARCMVDASDTSQGRAPDDLQRLVPLLDSSRLEAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTTSALAKRALRLLGEEVPRRILPSVPSWKEAEVQTWLQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMKSGIIRKRFLRELTELKTFANYATCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGICLGVHRARILTAAREMLHSPLPCTGGKPSGDAPDVFISYRRNTGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSIMSARNFVLVLSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPVIDGFKWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLESAAPPGPHLTSP 84B2E16046EB64CC p12259-pro_0000002979 Coagulation factor V heavy chain F5 Activated protein C cofactor Proaccelerin, labile factor protein protein human Homo sapiens Human AQLRQFYVAAQGISWSYRPEPTNSSLNLSVTSFKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYSKLSEGASYLDHTFPAEKMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIEDFNSGLIGPLLICKKGTLTEGGTQKTFDKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNGTMPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVLEQNHHKVSAITLVSATSTTANMTVGPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVIWDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILGPIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGETYTYKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIASGLIGLLLICKSRSLDRRGIQRAADIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYESNIMSTINGYVPESITTLGFCFDDTVQWHFCSVGTQNEILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVGTWMLTSMNSSPRSKKLRLKFRDVKCIPDDDEDSYEIFEPPESTVMATRKMHDRLEPEDEESDADYDYQNRLAAALGIR 29 737 76C01E946247F01F 1,2-dioleoyl-sn-glycero-3-phospho-l-serine 1,2-dioleoyl-sn-glycero-3-phospho-L-serine 1,2-Dioleoyl-sn-glycero-3-phosphoserine 1,2-Dioleoylphosphatidylserine 1,2-Dlps Dioleoyl phosphatidylserine DOPS DOPSE Phosphatidylserine(18:1/18:1) Phosphatidylserine(18:1omega9/18:1omega9) Phosphatidylserine(36:2) PS(18:1(9Z)/18:1(9Z)) PS(18:1/18:1) PS(18:1omega9/18:1omega9) PS(36:2) O-[({(2R)-2,3-bis[(9Z)-octadec-9-enoyloxy]propyl}oxy)(hydroxy)phosphoryl]-L-serine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) xlrs1_human Retinoschisin RS1 XLRS1 X-linked juvenile retinoschisis protein protein protein human Homo sapiens Human MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA A3893895E6A7E292 at1a3_human Sodium/potassium-transporting ATPase subunit alpha-3 Sodium pump subunit alpha-3 Na(+)/K(+) ATPase alpha(III) subunit ATP1A3 protein protein human Homo sapiens Human MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY BF28CD9F1E11AF48 f1mr06_bovin Sodium/potassium-transporting ATPase subunit alpha ATP1A3 protein protein bovin Bos taurus (Bovine) Bovine RPQSGGSDSYRVATSQDKKDDKGSPKKSKGTKDRRDLDDLKKEVAMVSPTLCFSERVLCESCVPQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNVPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLHGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLK CABAFD8E2470B1B2 at1a3_mouse Sodium/potassium-transporting ATPase subunit alpha-3 Sodium pump subunit alpha-3 Na(+)/K(+) ATPase alpha(III) subunit Atp1a3 protein protein mouse Mus musculus Mouse MGDKKDDKSSPKKSKAKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY 72F051406284EA8A sarm1_mouse NAD(+) hydrolase SARM1 Sarm1 Kiaa0524 NADP(+) hydrolase SARM1 Sterile alpha and TIR motif-containing protein 1 protein protein mouse Mus musculus Mouse MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALANCALHGGQTVQRCMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVEHSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQSLVLLLDSSRLEAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTTSALAKRALRLLGEEVPRRILPCVASWKEAEVQTWLQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMKSSITRKRFFRELTELKTFASYATCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIRLGVHRTRILSAAREMLHSPLPCTGGKLSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVIAARNFVLVLSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRPSQDSSAGSDTSLEGATPMGLP 9A5BF03ED22E6102 arg525his-1 4 11 unspecified role unspecified role prey prey whole_molecule sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 15 unspecified role unspecified role prey prey whole_molecule sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 16 unspecified role unspecified role bait bait 26 24 direct interaction direct interaction 1 1,2_dioleoyl_sn_glycero_3_phospho_l_serine-f5-1 6 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 15 unspecified role unspecified role neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 16 unspecified role unspecified role neutral component neutral component 31 33 physical association physical association 2A 425w-1 3 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association 3 xlrs1_bovin_protein-1 2 19 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association 4 xlrs1_bovin_protein-at1a3_bovin_protein-1 2 19 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 17 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association 4i rs1-atp1a3-1 5 20 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 5 rs1-atp1a3-2 1 20 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 6 C sarm1-atp1a3-1 1 20 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component colocalization colocalization 6 F