IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4. The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4. RNA (New York, N.Y.) 2007 imex curation Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu Accepted 2016-SEP-27 AT 09:07 BST AT 09:07 BST by ORCHARD RNA (New York, N.Y.) 2007 imex curation The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4. The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4. RNA (New York, N.Y.) 2007 imex curation Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu Accepted 2016-SEP-27 AT 09:07 BST AT 09:07 BST by ORCHARD RNA (New York, N.Y.) 2007 imex curation The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4. The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4. RNA (New York, N.Y.) 2007 imex curation Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as sequence tag sequence tag identification sequence tag Wilkinson ML., Crary SM., Jackman JE., Grayhack EJ., Phizicky EM. eric_phizicky@urmc.rochester.edu Accepted 2016-SEP-27 AT 09:07 BST AT 09:07 BST by ORCHARD RNA (New York, N.Y.) 2007 imex curation trm13_yeast tRNA:m(4)X modification enzyme TRM13 tRNA methylase 13 TRM13 YOL125W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLQDNNGPAVKRAKPSERLQCEYFMEKKKRRCGMTRSSQNLYCSEHLNLMKKAANSQVHNKNGSEAEKERERVPCPLDPNHTVWADQLKKHLKKCNKTKLSHLNDDKPYYEPGYNGENGLLSSSVKIDITAEHLVQSIELLYKVFEGESMDELPLRQLNNKLMSLKRFPQLPSNTKHAVQQSSLIENLVDAGAFERPESLNFIEFGCGRAEFSRYVSLYLLTQLTSLPAEHSGSNSNEFVLIDRATNRMKFDKKIKDDFSEIKSNSPSKPISCPSIKRIKIDIRDLKMDPILKSTPGDDIQYVCISKHLCGVATDLTLRCIGNSSILHGDDNNGCNPKLKAICIAMCCRHVCDYGDYVNRSYVTSLVEKYRAHGSILTYETFFRVLTKLCSWGTCGRKPGTAITDIVNVVESFEGAEPYTITIKERENIGLMARRVIDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAMLVYKK 3280A732FFA374C1 trna_gly_gcc tRNA_Gly_GCC trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCGCAAGUGGUUUAGUGGUAAAAUCCAACGUUGCCAUCGUUGGGCCCCCGGUUCGAUUCCGGGCUUGCGCA trna his gtg trna His GTG trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCCAUCUUAGUAUAGUGGUUAGUACACAUCGUUGUGGCCGAUGAAACCCUGGUUCGAUUCUAGGAGAUGGCA trm13 trnagly-1 2 5 enzyme target enzyme target substrate substrate neutral component neutral component label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 enzyme enzyme neutral component neutral component label tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 1D trm13-trna_gly_gcc-1 3 5 enzyme target enzyme target substrate substrate neutral component neutral component methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 enzyme enzyme neutral component neutral component tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 4B, Table 2 trna his_trm13-1 1 4 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig5 trm13-trna_gly_gcc-2 1 4 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig5 trm13-trna his gtg-1 2 6 enzyme target enzyme target substrate substrate neutral component neutral component A methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 enzyme enzyme neutral component neutral component tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 6 trm13-trna_gly_gcc-3 3 5 enzyme target enzyme target substrate substrate neutral component neutral component methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 enzyme enzyme neutral component neutral component tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast methylation methylation reaction methylation Fig 4B, Table 2