IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Molecular and cellular biology 2007 imex curation Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. Dark space = 63? billadeau.daniel@mayo.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. billadeau.daniel@mayo.edu Accepted 2017-MAR-06 AT 08:31 GMT AT 08:31 GMT by ORCHARD Molecular and cellular biology 2007 imex curation It is stated that " only the ABRSH3 fully inhibited exchange activity (Fig. 6E). "- the error bars for individual SH3 and ABR domains overlap with the GST error bars=no significant difference.; There are two Asef2 constructs used - (short form 205-652 and full length) which have different GO terms attached due to coloc. for each being in different parts of the cell. I could have added as one interaction but it would not be clear that the short construct colocalises to different regions than full lenght mol. I have altered the wording of the comment and corrected the mutant name (it should NOT have been delta 2094.) Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Molecular and cellular biology 2007 imex curation Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. Dark space = 63? billadeau.daniel@mayo.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange tag visualisation tag visualisation Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. To start the reaction unlabelled GTP is added in excess. GDP/GTP exchange activity is assessed by counting the decrease in signal from isolated, radiolabelled GDP-GTPase at the end of the reaction period. Lipid-modified forms of CDC42 were prepared from membrane fractions of Sf9 cells. (from Ref 40). Vav has been assumed to be of of Human origin via ref 15. -see PMID:8760286. Rac 1 has also been assumed to be of Human origin- ref 37. The sequence of CDC42 has been conserved in several mammalian species. It has been entered as being of Human origin;Ref 28 gives several sequences of CDC42 all of which are found in the Human protein. (as well as mouse/rat plus several other species which have identical CDC42 sequences.) billadeau.daniel@mayo.edu Accepted 2017-MAR-06 AT 08:31 GMT AT 08:31 GMT by ORCHARD Molecular and cellular biology 2007 imex curation It is stated that " only the ABRSH3 fully inhibited exchange activity (Fig. 6E). "- the error bars for individual SH3 and ABR domains overlap with the GST error bars=no significant difference.; There are two Asef2 constructs used - (short form 205-652 and full length) which have different GO terms attached due to coloc. for each being in different parts of the cell. I could have added as one interaction but it would not be clear that the short construct colocalises to different regions than full lenght mol. I have altered the wording of the comment and corrected the mutant name (it should NOT have been delta 2094.) Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Molecular and cellular biology 2007 imex curation Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. Dark space = 63? billadeau.daniel@mayo.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-panc04-03 human-panc04-03 Pancreatic ductal adenocarcinoma cell line Human panc04-03 panc04-03 Pancreatic ductal adenocarcinoma cell line https://www.lgcstandards-atcc.org/products/all/CRL-2555 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. billadeau.daniel@mayo.edu Accepted 2017-MAR-06 AT 08:31 GMT AT 08:31 GMT by ORCHARD Molecular and cellular biology 2007 imex curation It is stated that " only the ABRSH3 fully inhibited exchange activity (Fig. 6E). "- the error bars for individual SH3 and ABR domains overlap with the GST error bars=no significant difference.; There are two Asef2 constructs used - (short form 205-652 and full length) which have different GO terms attached due to coloc. for each being in different parts of the cell. I could have added as one interaction but it would not be clear that the short construct colocalises to different regions than full lenght mol. I have altered the wording of the comment and corrected the mutant name (it should NOT have been delta 2094.) Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Molecular and cellular biology 2007 imex curation Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. Dark space = 63? billadeau.daniel@mayo.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. billadeau.daniel@mayo.edu Accepted 2017-MAR-06 AT 08:31 GMT AT 08:31 GMT by ORCHARD Molecular and cellular biology 2007 imex curation It is stated that " only the ABRSH3 fully inhibited exchange activity (Fig. 6E). "- the error bars for individual SH3 and ABR domains overlap with the GST error bars=no significant difference.; There are two Asef2 constructs used - (short form 205-652 and full length) which have different GO terms attached due to coloc. for each being in different parts of the cell. I could have added as one interaction but it would not be clear that the short construct colocalises to different regions than full lenght mol. I have altered the wording of the comment and corrected the mutant name (it should NOT have been delta 2094.) Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Molecular and cellular biology 2007 imex curation Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. Dark space = 63? billadeau.daniel@mayo.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. Reference 37 states that Rac1 is of human origin. billadeau.daniel@mayo.edu Accepted 2017-MAR-06 AT 08:31 GMT AT 08:31 GMT by ORCHARD Molecular and cellular biology 2007 imex curation It is stated that " only the ABRSH3 fully inhibited exchange activity (Fig. 6E). "- the error bars for individual SH3 and ABR domains overlap with the GST error bars=no significant difference.; There are two Asef2 constructs used - (short form 205-652 and full length) which have different GO terms attached due to coloc. for each being in different parts of the cell. I could have added as one interaction but it would not be clear that the short construct colocalises to different regions than full lenght mol. I have altered the wording of the comment and corrected the mutant name (it should NOT have been delta 2094.) Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element. Molecular and cellular biology 2007 imex curation Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. Dark space = 63? billadeau.daniel@mayo.edu 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions human-bxpc3 Homo sapiens primary pancreatic adenocarcinoma cell line bxpc3 BxPC-3 Human primary pancreatic adenocarcinoma cell line Derived from a 61 year old female with a primary adenocarcinoma of the pancreas. BxPC-3 cells produce mucin and the tumour in a nude mouse is moderately well to poorly differentiated like the primary adenocarcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Hamann MJ., Lubking CM., Luchini DN., Billadeau DD. Results from the GTPase activation assays have not been included as the origins of the GST-PAK-CRIB fusion protein and GST-rhoteckin Rho binding domain fusion protein cannot be traced. the GST tagged proteins (PAK + Rho) are most likely Human - but the stated reference cannot be opened, and I cannot see any other obvious reference to the proteins/kits. billadeau.daniel@mayo.edu Accepted 2017-MAR-06 AT 08:31 GMT AT 08:31 GMT by ORCHARD Molecular and cellular biology 2007 imex curation It is stated that " only the ABRSH3 fully inhibited exchange activity (Fig. 6E). "- the error bars for individual SH3 and ABR domains overlap with the GST error bars=no significant difference.; There are two Asef2 constructs used - (short form 205-652 and full length) which have different GO terms attached due to coloc. for each being in different parts of the cell. I could have added as one interaction but it would not be clear that the short construct colocalises to different regions than full lenght mol. I have altered the wording of the comment and corrected the mutant name (it should NOT have been delta 2094.) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 q96n96-1 Spermatogenesis-associated protein 13 APC-stimulated guanine nucleotide exchange factor 2 ASEF-2b SPATA13 protein protein human Homo sapiens Human MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQLAINELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPASFVRLRVNQEELSENSSSTPSEEQDEEASQSRHRHCENKQQMRTNVIREIMDTERVYIKHLRDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGACLELANLMKQGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACLINERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFDHQLVSCKKDLLRRDMLYYKGRLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADERRRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLTPFRK 7C922E8AF0A9C836 q9nr80-3 Rho guanine nucleotide exchange factor 4 ARHGEF4 KIAA1112 APC-stimulated guanine nucleotide exchange factor 1 protein protein human Homo sapiens Human MRPDGQQALDAVVRSFDCHSEAALRQRNDVIYCSLPRTAQGIVQREDQLEVLVSLREVWGRRRGRDGTCTGAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYIKHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSELGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFLLTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETGFSITELQRKQAMLNASKQQVTGKPKAVGRPCYLTRQKHPALPSNRPQQQVLVLAEPRRKPSTFWHSISRLAPFRK 2FEAB258AB1687C5 spt13_human Spermatogenesis-associated protein 13 SPATA13 APC-stimulated guanine nucleotide exchange factor 2 protein protein human Homo sapiens Human MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQLAINELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPASFVRLRVNQEELSENSSSTPSEEQDEEASQSRHRHCENKQQMRTNVIREIMDTERVYIKHLRDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGACLELANLMKQGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACLINERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFDHQLVSCKKDLLRRDMLYYKGRLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADERRRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLTPFRK 7C922E8AF0A9C836 vav_human Proto-oncogene vav VAV1 VAV protein protein human Homo sapiens Human MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREVNLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKMDRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC AC3BC9736FD2F138 apc_human Adenomatous polyposis coli protein APC DP2.5 Deleted in polyposis 2.5 protein protein human Homo sapiens Human MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQATEAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKSSSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPVSEVPAVSQHPRTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQSGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLNAERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINRGQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENNNKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKGLNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV DIP protein P25054 original sequence version: 143 DIP protein P25054-1 original sequence version: 157 DIP protein P25054 original sequence version: 158 77E194AE4A91DC5A gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF 54wsrt-1 5 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-bxpc3 Homo sapiens primary pancreatic adenocarcinoma cell line bxpc3 BxPC-3 Human primary pancreatic adenocarcinoma cell line Derived from a 61 year old female with a primary adenocarcinoma of the pancreas. BxPC-3 cells produce mucin and the tumour in a nude mouse is moderately well to poorly differentiated like the primary adenocarcinoma 8 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P63000:p.Thr17Asn mutation mutation certain certain sequence position certain certain certain sequence position certain T N Wed May 02 17:16:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 16:07:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A cdc42-gdp-6 2 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region lipoconjugated residue lipoconjugated residue undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 27 30 direct interaction direct interaction 2 B/C The exchange activity of Asef2 was only detected with the lipid-modified form of Cdc42. [The exact nature of this lipid-modification is not stated and could involve more than one type of PTM.] refs 40 + 41 refer to several types of cdc42 PTMs - as it was isolated from membranes fractions -could be all/any of these. UniProt refers to a S-geranylgeranyl cysteine mod also. cdc42-gdp-1 2 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region lipoconjugated residue lipoconjugated residue undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range DH_and_PH_domains sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 39 42 direct interaction direct interaction 2 D arhgef4-cdc42-1 2 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region lipoconjugated residue lipoconjugated residue undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 53 50 direct interaction direct interaction 2 D positive control 46syed-1 1 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 4A spata13-apc-3 1 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 4Ai apc-spata13-2 3 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 4B apc-spata13-5 4 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait region_including_arm_repeats sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P25054:p.Leu204_Gly205insGluGlu mutation mutation certain certain sequence position certain certain certain sequence position certain LG LEEG Tue May 09 10:33:20 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'gly205-205glu_glu_gly' Wed May 02 14:52:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly205glu_glu_gly' Tue Jun 30 17:54:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu204_Gly205insGluGlu' physical association physical association 4C apc-spata13-3 5 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range partial_SH3_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region_including_arm_repeats sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P25054:p.Leu204_Gly205insGluGlu mutation mutation certain certain sequence position certain certain certain sequence position certain LG LEEG Tue May 09 10:52:14 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'gly205-205glu_glu_gly' Wed May 02 19:57:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly205glu_glu_gly' Tue Jun 30 19:06:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu204_Gly205insGluGlu' human Homo sapiens Human 77 79 physical association physical association 4E spata13-apc-4 5 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ABR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region_including_arm_repeats sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P25054:p.Leu204_Gly205insGluGlu mutation mutation certain certain sequence position certain certain certain sequence position certain LG LEEG Tue May 09 10:52:43 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'gly205-205glu_glu_gly' Wed May 02 15:19:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly205glu_glu_gly' Tue Jun 30 19:18:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu204_Gly205insGluGlu' human Homo sapiens Human 84 86 physical association physical association 4Ei cdc42-gdp-2 2 13 stimulator stimulator neutral component neutral component n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region_including_arm_repeats sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 95 97 direct interaction direct interaction 5A The MBP-APC-arm construct stimulated Asef2 activity to a level that was comparable to the Delta-204 truncation mutant. spata13-apc-5 6 9 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component region_including_arm_repeats sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 5C The Asef2 Delta 204 mutant induced filopodia formation but did not accumulate/colocalise in them in the presence of YFP-APC-arm. there is no GO term for "cell perimeter", but there IS one for (GO:0071944) "Cell Periphery".-but as these terms are not necessarily meaning the same thing (?) I have not entered any term relating to this for the non-mutant Asef2 interaction. apc-spata13-4 6 9 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component region_including_arm_repeats sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 5Ci The Asef2 Delta 204 mutant induced filopodia formation but did not accumulate/colocalise in them in the presence of YFP-APC-arm. spata13-apc-6 5 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ABR_and_SH3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association 6C-top The cells expressing Flag tagged Asef proteins may have been HeLa cells. spata13-spata13-1 5 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ABR_and_SH3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association 6C-bottom The cells expressing Flag tagged Asef proteins may have been HeLa cells. spata13-spata13-2 5 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ABR_and_SH3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction 6D cdc42-gdp-3 2 9 inhibitor inhibitor neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ABR_and_SH3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region lipoconjugated residue lipoconjugated residue undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 144 141 direct interaction direct interaction 6E spata13-arhgef4-1 5 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ABR_and_SH3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal_tail required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 152 155 physical association physical association 7A spata13-spata13-3 5 9 unspecified role unspecified role prey prey ABR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ABR_and_SH3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain sh3_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 7B cdc42-gdp-4 2 9 stimulator stimulator neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region lipoconjugated residue lipoconjugated residue undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 176 173 direct interaction direct interaction 7C cdc42-gdp-5 2 9 stimulator stimulator neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region lipoconjugated residue lipoconjugated residue undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 191 188 direct interaction direct interaction 8D The expression system and tags are not stated for the 204 to 620 tail deletion fragment.