UniProt UniProt http://www.uniprot.org A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. Molecular and cellular biology 2005 imex curation Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. The transfected bait vector contains sequences of CASP3 p12 and CASP p17, both with separate promoters for expression in yeast Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Accepted 2016-MAR-15 AT 11:52 GMT AT 11:52 GMT by MGT Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. Molecular and cellular biology 2005 imex curation Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Accepted 2016-MAR-15 AT 11:52 GMT AT 11:52 GMT by MGT Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. Molecular and cellular biology 2005 imex curation Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep2 Homo sapiens hep2 hep2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Accepted 2016-MAR-15 AT 11:52 GMT AT 11:52 GMT by MGT Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. Molecular and cellular biology 2005 imex curation Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Accepted 2016-MAR-15 AT 11:52 GMT AT 11:52 GMT by MGT Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. Molecular and cellular biology 2005 imex curation Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Accepted 2016-MAR-15 AT 11:52 GMT AT 11:52 GMT by MGT Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. A-kinase-anchoring protein 95 functions as a potential carrier for the nuclear translocation of active caspase 3 through an enzyme-substrate-like association. Molecular and cellular biology 2005 imex curation Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep2 Homo sapiens hep2 hep2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Accepted 2016-MAR-15 AT 11:52 GMT AT 11:52 GMT by MGT Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH DIP protein P42574 original sequence version: 108 DIP protein P42574 original sequence version: 171 DIP protein P42574 original sequence version: 111 DIP protein P42574 original sequence version: 105 DIP protein P42574 original sequence version: 131 DIP protein P42574 original sequence version: 132 DIP protein P42574 original sequence version: 134 DIP protein P42574 original sequence version: 162 DIP protein P42574 original sequence version: 189 DIP protein P42574 original sequence version: 167 2F35CD3BCF7FF64A p42574-pro_0000004571 Caspase-3 subunit p17 CASP3 CPP32 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 protein protein human Homo sapiens Human SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD 29 175 5D58195D74B47405 akap8_human A-kinase anchor protein 8 AKAP8 AKAP95 A-kinase anchor protein 95 kDa protein protein human Homo sapiens Human MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEAAKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQDRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARERGSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSPSRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDGTGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEKEDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE DIP protein O43823 original sequence version: 118 CBCD5F014FD94B66 p42574-pro_0000004572 Caspase-3 subunit p12 CASP3 CPP32 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 protein protein human Homo sapiens Human SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH 176 277 05FEC4A09DEB56D0 akap8_mouse A-kinase anchor protein 8 Akap8 Akap95 A-kinase anchor protein 95 kDa protein protein mouse Mus musculus Mouse MEQGYGGYGAWSAGPANTQGTYGSGMTSWQGYENYNYYNAQNTSVPAGTPYSYGPASWEATKTNDGGLAAGSPAMHVASFAPEPCTDNSDSLIAKINQRLDMLSKEGGRGGISSGGEGVQDRDSSFRFQPYESYDARPCIPEHNPYRPGYGYDYDFDLGTDRNGSFGGTFNDCRDPAPERGSLDGFLRGRGQGRFQDRSNSSTFIRSDPFMPPSASEPLSTTWNELNYMGGRGLGGPSTSRPPPSLFSQSMAPDYSMMGMQGVGGFGGTMPYGCGRSQTRIRDWPRRRGFERFGPDNMGRKRKQFPLYEEPDAKLARADSDGDLSENDDGAGDLRSGDEEFRGEDDLCDSRKQRGEKEDEDEDVKKRREKQRRRDRMRDRAADRIQFACSVCKFRSFEDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIINRNKKIEKRRQELLEKESPKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQHQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNKHIVKMLEKYLKGEDPFVNETADLETEGDENVGEEKEETPEEVAAEVLAEVITAAVKAVEGEGEPAAAHSDVLTEVEGPVDTAEASSDPHTEKLLEEQTCEAASETRSIEDKTRGEAAEARNEAAMPTADAGSTLPVIAIPGIMEDELEQTGAEAKDIPTE BC1E320216A47E10 casp3-akap8-1 1 8 unspecified role unspecified role ancillary ancillary P42574-PRO_0000004571:p.Cys135Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:22:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys135ser' Tue Jun 30 17:56:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys135Ser' 10 unspecified role unspecified role bait bait P42574-PRO_0000004572:p.Arg32Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R E Wed May 02 16:27:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg32glu' Tue Jun 30 15:55:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg32Glu' 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9DBR0:p.Glu675Gly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E G Wed May 02 17:26:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu675gly' Tue Jun 30 18:34:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu675Gly' Q9DBR0:p.Thr677Gly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T G Wed May 02 15:15:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr677gly' Tue Jun 30 15:47:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr677Gly' physical association physical association Table 1 akap8-casp3-2 5 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range derived from transfected casp3-Wt-GFP physical association physical association 3A akap8-casp3-1 5 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range derived from transfected GFP-(delta)pro-casp3-wt 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 3A akap8-casp3-3 5 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3B akap8-casp3-5 4 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 3B akap8-casp3-6 4 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection dsred fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 3B casp3-akap8-2 2 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus xpress tag xpress tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3C akap8-casp3-4 6 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 3D A low level (<1%) of procaspase 3 coprecipitating with AKAP95 in the supernatant fraction was detected. akap8-casp3-7 3 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection colocalization colocalization 4B right Observed in apoptotic cells