UniProt UniProt http://www.uniprot.org Selective interactions of Kruppel-like factor 9/basic transcription element-binding protein with progesterone receptor isoforms A and B determine transcriptional activity of progesterone-responsive genes in endometrial epithelial cells. Selective interactions of Kruppel-like factor 9/basic transcription element-binding protein with progesterone receptor isoforms A and B determine transcriptional activity of progesterone-responsive genes in endometrial epithelial cells. The Journal of biological chemistry 2003 imex curation Zhang XL., Zhang D., Michel FJ., Blum JL., Simmen FA., Simmen RC. simmenrosalia@uams.edu Only protein-protein interactions human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang XL., Zhang D., Michel FJ., Blum JL., Simmen FA., Simmen RC. 'This experiment relates to a negative interaction. Cells pretreated with R5020, a progestin and an agonist for the progesterone receptor. simmenrosalia@uams.edu Accepted 2017-FEB-13 AT 09:12 GMT AT 09:12 GMT by MGT The Journal of biological chemistry 2003 imex curation did the negative interactions for mouse uterus and human t47d. not for pig, we have no isoform info. they say for pig the results confirm data from a another paper (ref 24) which i have no on line access for. Selective interactions of Kruppel-like factor 9/basic transcription element-binding protein with progesterone receptor isoforms A and B determine transcriptional activity of progesterone-responsive genes in endometrial epithelial cells. Selective interactions of Kruppel-like factor 9/basic transcription element-binding protein with progesterone receptor isoforms A and B determine transcriptional activity of progesterone-responsive genes in endometrial epithelial cells. The Journal of biological chemistry 2003 imex curation Zhang XL., Zhang D., Michel FJ., Blum JL., Simmen FA., Simmen RC. simmenrosalia@uams.edu Only protein-protein interactions mouse-uterus mouse uterus Mouse uterus Uterus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang XL., Zhang D., Michel FJ., Blum JL., Simmen FA., Simmen RC. This experiment relates to a negative interaction mouse uterus at peri-implantation: days 1–8 of pregnancy simmenrosalia@uams.edu Accepted 2017-FEB-13 AT 09:12 GMT AT 09:12 GMT by MGT The Journal of biological chemistry 2003 imex curation did the negative interactions for mouse uterus and human t47d. not for pig, we have no isoform info. they say for pig the results confirm data from a another paper (ref 24) which i have no on line access for. q00175-2 Progesterone receptor Nuclear receptor subfamily 3 group C member 3 Pgr Nr3c3 Pr PRA PR-A protein protein mouse Mus musculus Mouse MSRPEIKAGDSSGTGAGQKVLPKGLSPPRQLLLPTSGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGSGGGVAANAASAAPGGVTLVPKEDSRFSAPRVSLEQDSPIAPGRSPLATTVVDFIHVPILPLNHALLAARTRQLLEGDSYDGGATAQGPFAPPRGSPSAPSPPVPCGDFPDCTYPLEGDPKEDVFPLYGDFQTPGLKIKEEEEGADAAVRSPRPYLSAGASSSTFPDFPLAPAPQRAPSSRPGEAAVAGGPSSAAVSPASSSGSALECILYKAEGAPPTQGSFAPLPCKPPAAGSCLLPRDSLPAAPATAAAPAIYQPLGLNGLPQLGYQAAVLKDSLPQVYPPYLNYLRPDSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLDGVALPQSVGLPNESQALGQRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSSYIRELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRTLAVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK 0C457B06AE0BA0BA p06401-2 Progesterone receptor PGR NR3C3 Nuclear receptor subfamily 3 group C member 3 PR-A PRA protein protein human Homo sapiens Human MSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK DIP protein P06401-2 original sequence version: 192 Produced by alternative promoter usage. FE676F25282983F3 klf9_human Krueppel-like factor 9 KLF9 BTEB BTEB1 Basic transcription element-binding protein 1 GC-box-binding protein 1 Transcription factor BTEB1 protein protein human Homo sapiens Human MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKALANAL 2D1B5A5BB9D42221 klf9_mouse Krueppel-like factor 9 Klf9 Bteb Bteb-1 Bteb1 Basic transcription element-binding protein 1 GC-box-binding protein 1 Transcription factor BTEB1 protein protein mouse Mus musculus Mouse MSAAAYMDFVAAQCLVSISNRAAVPEHGGAPEAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDIGSDSDVTTESGSSPSHSPEERQDSGSAPSPLSLLHSGVASKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTVFHPSMIKRSKKALACPL BBDF607FFA218D5A klf9-pgr-4 2 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association true 7B klf9-pgr-5 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association true 7B