IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop. Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop. The EMBO journal 2002 imex curation Pintard L., Lecointe F., Bujnicki JM., Bonnerot C., Grosjean H., Lapeyre B. lapeyre@crbm.cnrs-mop.fr 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Pintard L., Lecointe F., Bujnicki JM., Bonnerot C., Grosjean H., Lapeyre B. yeast extracts were incubated with labeled AdoMet. After UV crosslinking, Trm7 was immunoprecipitated and the presence of Ado Met verified by autoradiography lapeyre@crbm.cnrs-mop.fr Accepted 2016-SEP-29 AT 08:38 BST AT 08:38 BST by MGT The EMBO journal 2002 imex curation Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop. Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop. The EMBO journal 2002 imex curation Pintard L., Lecointe F., Bujnicki JM., Bonnerot C., Grosjean H., Lapeyre B. lapeyre@crbm.cnrs-mop.fr 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Pintard L., Lecointe F., Bujnicki JM., Bonnerot C., Grosjean H., Lapeyre B. lapeyre@crbm.cnrs-mop.fr Accepted 2016-SEP-29 AT 08:38 BST AT 08:38 BST by MGT The EMBO journal 2002 imex curation trm7_yeast tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase TRM7 2'-O-ribose RNA methyltransferase TRM7 tRNA methylase 7 YBR0527 YBR061C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALELKRSGKLTRSV 3C7F2583F2012CCB 3C7F2583F2012CCB trna phe gaa trna Phe GAA trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCGGAUUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAUCUGGAGGUCCUGUGUUCGAUCCACAGAAUUCGCA s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) trm7-s_adenosyl_l_methionine-1 1 5 unspecified role unspecified role prey prey label 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region zz tag zz tag ZZ tag ZZ tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig 3C trm7-trna phe gaa-1 2 4 enzyme target enzyme target substrate substrate neutral component neutral component label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain G methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain in vitro In vitro 3 enzyme enzyme neutral component neutral component tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P38238:p.Asp49Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Mon Oct 03 15:00:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'Asp49Ala' Wed May 02 18:37:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp49ala' Tue Jun 30 17:15:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp49Ala' yeast Saccharomyces cerevisiae Baker's yeast methylation methylation reaction methylation Fig 8E-H