IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation. The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation. Structure (London, England : 1993) 2001 imex curation Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD., Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD. benjamin_d_bax@gsk.com 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD., Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD. benjamin_d_bax@gsk.com Accepted 2016-OCT-05 AT 15:06 BST AT 15:06 BST by MGT Structure (London, England : 1993) 2001 Only protein-protein interactions imex curation imex curation The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation. The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation. Structure (London, England : 1993) 2001 imex curation Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD., Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD. benjamin_d_bax@gsk.com 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD., Bax B., Carter PS., Lewis C., Guy AR., Bridges A., Tanner R., Pettman G., Mannix C., Culbert AA., Brown MJ., Smith DG., Reith AD. benjamin_d_bax@gsk.com Accepted 2016-OCT-05 AT 15:06 BST AT 15:06 BST by MGT Structure (London, England : 1993) 2001 Only protein-protein interactions imex curation imex curation frat1_human Proto-oncogene FRAT1 FRAT1 Frequently rearranged in advanced T-cell lymphomas 1 protein protein human Homo sapiens Human MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS 629AFD6CEA1DC0BD gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD DIP protein O15169 original sequence version: 118 DIP protein O15169 original sequence version: 125 DIP protein O15169-1 original sequence version: 140 DIP protein O15169 original sequence version: 132 10779173F5092F3F frat1-gsk3b-1 2 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 11 9 direct interaction direct interaction Table 2 R working 0.196, R free 0.262 2.6A axin1-gsk3b-4 1 4 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 unspecified role unspecified role neutral component neutral component O15169:p.Leu396Met mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L M Wed May 02 16:05:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu396met' Tue Jun 30 16:33:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu396Met' O15169:p.Leu392Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 14:41:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu392pro' Tue Jun 30 19:57:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu392Pro' O15169:p.Leu392Met mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L M Wed May 02 15:22:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu392met' Tue Jun 30 18:57:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu392Met' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal tamra fluorescent dye fluorescent dye label fluorescent dye n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 20 15 direct interaction direct interaction Table 1