IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. RNA (New York, N.Y.) 1998 imex curation Watkins NJ., Gottschalk A., Neubauer G., Kastner B., Fabrizio P., Mann M., Lührmann R. luehrmann@imt.uni-marburg.de 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip northern blot northern blot northen Watkins NJ., Gottschalk A., Neubauer G., Kastner B., Fabrizio P., Mann M., Lührmann R. luehrmann@imt.uni-marburg.de Accepted 2015-AUG-18 by ORCHARD RNA (New York, N.Y.) 1998 imex curation Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. RNA (New York, N.Y.) 1998 imex curation Watkins NJ., Gottschalk A., Neubauer G., Kastner B., Fabrizio P., Mann M., Lührmann R. luehrmann@imt.uni-marburg.de 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip northern blot northern blot northen Watkins NJ., Gottschalk A., Neubauer G., Kastner B., Fabrizio P., Mann M., Lührmann R. luehrmann@imt.uni-marburg.de Accepted 2015-AUG-18 by ORCHARD RNA (New York, N.Y.) 1998 imex curation Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. RNA (New York, N.Y.) 1998 imex curation Watkins NJ., Gottschalk A., Neubauer G., Kastner B., Fabrizio P., Mann M., Lührmann R. luehrmann@imt.uni-marburg.de 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast chromatography chromatography technology column chromatography chromatography sequence tag sequence tag identification sequence tag Watkins NJ., Gottschalk A., Neubauer G., Kastner B., Fabrizio P., Mann M., Lührmann R. luehrmann@imt.uni-marburg.de Accepted 2015-AUG-21 by ORCHARD RNA (New York, N.Y.) 1998 imex curation cbf5_yeast H/ACA ribonucleoprotein complex subunit CBF5 Small nucleolar RNP protein CBF5 L9470.11 YLR175W CBF5 Centromere/microtubule-binding protein CBF5 Centromere-binding factor 5 H/ACA snoRNP protein CBF5 p64' protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKEDFVIKPEAAGASTDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVKRQLRVRTIYESNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGALSENDNMVTLHDVMDAQWVYDNTRDESYLRSIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELYDEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRWGLGPVAQKKKQMKADGKLDKYGRVNENTPEQWKKEYVPLDNAEQSTSSSQETKETEEEPKKAKEDSLIKEVETEKEEVKEDDSKKEKKEKKDKKEKKEKKEKKDKKEKKEKKEKKRKSEDGDSEEKKSKKSKK D356B39FDCC32E2D D356B39FDCC32E2D snr3 yeast small nucleolar RNA 3 yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACUUUGUCCUAAAGUACUAAUCCACCGCAUUAGACAGUACGAAGAUCGAGCUAUUUAUUUGAACACUCGGUCUUAUUCGUGAUAAGCGUAAUGUGGAGAGAUCAAUUUCCGGGUCAUUUAUAAGAACUCGAGUGGAUUGCUAGUUGUUUUGAUUAGCUGAAUGAGACUCGAGUGUCAGAAGAUGACUAUAUUU gar1_yeast H/ACA ribonucleoprotein complex subunit GAR1 YHR089C GAR1 snoRNP protein GAR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR C197FE85644DD0F8 C197FE85644DD0F8 snr37_yeast_rna small nucleolar RNA 37 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACAUCAGUAGUGGUUAAUACUAUCUUUAGAUAAUAUUAAUUUCAUUAUACCAUAGAAACCUAAAGAUUAGGUUAUUUUCGUUCUUCAUGUUAUGGAGUGUGAGUGAUGAGGAGCUUGCUCUUUUAAGCUCAUAUUACGUAAUAAGUUAAUACUGGAGCGAGAAUAAUUUAAAUCAUUUCAUCAUAACCCAUAGCUGAAUGAACUUUGACUACUCCUAAACAAAGUAGUAACAAUUUUCAUUUCGUUUCCGGUUUCUUAGAUCGAAUAUUAUUCUGAGGAAAUUCCCUGAUUACAUAUCAGGGAAAGGUUCGCGUUUUUAGAGAAUUGCGUAAUGCGAUUUGAAAGUUUAAAUUCCUAAGCGACUCUUCUUCAUGAUAAGACAGUU snr11 yeast small nucleolar RNA 11 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AAUAAUGUCUUUUAUAAUAGACACCCAGAGUCACGAUUCGUCUUGGUUUUAGAGAUUCUGUUUCGACAGUUUUUUUAGGCGGUGGACGUAUAUAGUUUACUUAAUCGUUUACUAUACGGUGGAGUACUAAUACUAUUUCACUGUCGUGCUCGCGGUUGAUCUUAGAUAAAUAUAUUUCUUUUUCAUAAAGAAAGUGAGUGGAUCUUCCCUGGAAGUACGAAUAAUGUACUUAUGAUUAGAUUCUCUUCACGCACAUAC snr10_yeast_rna small nucleolar RNA 10 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACGCAAAUUUAACAGCCAUUCGUAACACGUACAGUAUCUCGUCGAGGUUGAACCCCUCCGGGGCGUUCUUGACCCAUGAAGAAUGUGGAUUGGUGUUGCAAUAUAUUUAUUAUUGGCUUGGACUGGAGAACAAAUUUAUCGAUCUUGGGUGCAACAGUCUUUCUGUCGUCUGUUUUUUAGCAGAUCUAAGGGUUUACCUUCGUGUGCCCGGAUGAGGACCGUUGCAAGGAUUGAUAAUACAACU nhp2_yeast H/ACA ribonucleoprotein complex subunit NHP2 NHP2 YDL208W D1045 H/ACA snoRNP protein NHP2 High mobility group-like nuclear protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL 008188132B494E5D 008188132B494E5D snr30_yeast_rna small nuclear RNA 30 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACCAUAGUCUCGUGCUAGUUCGGUACUAUACAGGGAAGGGAAGUCACUCGCAUACGUGUGUGUGCAUUUCUUGCUAUUGCUGCUUAGCUUCUCUAAAACACUGGGCUAGCGUUUUUCAACGCUCGAGAGGCAGAGUCUCAAGGAGCCUCCAAUGGGCCUCACGUAUUCAUCUAGAUGGCGCUUCGGACAACGGCAUCACAUAAGAGAUGCAGCUCCUGACUUCUCCUCUGAUCUUCGUGAUCAGAGUUUUGAGUCGUCAGACUACGAGCAGUUUCUCUUAGUCGUUGCAUCGGGUGCUGUUGCCUUAACGAUGUGUAUAUGGGGUUCGGGGGCUGUUGCCAUGAUAUAUAUGGAUGAGACAGAAGUGGCCCCGUUGACGAGUUUAACUUAGAUUAAGUAGGACGCAUGAUCUUGAGCUCUUUUCCUAUACUUUGUCCUAUGGCCAGCUUUCUCCUUAUUACGAAGAGAUUGCGGGAUGUGGGUGCAGAGUGGGAAAAUCUGAGUUCGGUCAUCUUUGUUGUUCGUCCUACCGCAGUAUAUUCCUAAACACUAUGAAAUGACCCUAGUUGGUCCAUGAUCAUUUGGGUAAAACCAUACUGCAGACA snr 43 yeast small nucleolar RNA 43 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast CACUCCUGUUUCUGCCUCAUGUCUUUUAAAACGCUUCCACGGGACAUGGGUUCUAAUUAUGGAGAAGAUCAAGCUUUGAAAUGGCCCGUUUACACAUUUUGAUACAACCGUAGACGGCGUCUCGUUUCAAAGACCGUGUGGUUGUCUAUCAGUAUAUACUCAUUGUGUUUUUCAAAAAAUCUCUGGGUUGUUUAGAUGCCACUAUAUUU snr42 yeast small nucleolar RNA 42 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AUAACAAUUUGUGAUGCUUUAGGGAGCCUAUUGUUUGAUGGUUUAUAGGAGCCGGAUUUGUCUUUUUGACUAAUUUUCAACCUAUUCUUACUUCCAAAACUGUUGCAAUGGCUCUCGUUUUUUUUAAAUUUUUCUCUUUUCUCUUCUUUGGCAUAGUUUAUUUUUAAUAAAUUAUUUCAGGGUGAGAUAGAGAAAGGAUAAUGAGUAUCGUAGAUAAAUCUUCGGUUCCGAAUAGUGUAACUGUUGGUGCUGAGGUAAUCCAUCUUUAAAACCAUCGCCGUUAGAGGUUGCUUCUGAUAUUUUCGGUUAAGCGACCCAUGAAAUGGUGAUGACCUGAGGUAUGGAACAUCU gar1p_snr42-1 3 10 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 13 northern blot northern blot northen sequence tag sequence tag identification sequence tag unspecified role unspecified role neutral component neutral component association association Fig1 Fig2 gar1p_snr30-2 3 10 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 11 northern blot northern blot northen sequence tag sequence tag identification sequence tag unspecified role unspecified role neutral component neutral component association association Fig1, Fig2 cbf5_snrna-1 1 5 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait association association Fig3A nhp2-1 2 10 unspecified role unspecified role bait bait tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association Fig3A