IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Assembly of human neuronal nicotinic receptor alpha5 subunits with alpha3, beta2, and beta4 subunits. Assembly of human neuronal nicotinic receptor alpha5 subunits with alpha3, beta2, and beta4 subunits. The Journal of biological chemistry 1996 imex curation Wang F., Gerzanich V., Wells GB., Anand R., Peng X., Keyser K., Lindstrom J. Only protein-protein interactions imex curation xenla-oocyte Xenopus laevis oocyte Oocyte anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang F., Gerzanich V., Wells GB., Anand R., Peng X., Keyser K., Lindstrom J. Accepted 2015-APR-30 by ORCHARD The Journal of biological chemistry 1996 Only protein-protein interactions imex curation imex curation Assembly of human neuronal nicotinic receptor alpha5 subunits with alpha3, beta2, and beta4 subunits. Assembly of human neuronal nicotinic receptor alpha5 subunits with alpha3, beta2, and beta4 subunits. The Journal of biological chemistry 1996 imex curation Wang F., Gerzanich V., Wells GB., Anand R., Peng X., Keyser K., Lindstrom J. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang F., Gerzanich V., Wells GB., Anand R., Peng X., Keyser K., Lindstrom J. Accepted 2015-APR-30 by ORCHARD The Journal of biological chemistry 1996 Only protein-protein interactions imex curation imex curation I've deleted the interaction for lane 2, I think Lane 5/6 is fine, Abs are specific to beta2 (IP) and alpha5 (detection). Assembly of human neuronal nicotinic receptor alpha5 subunits with alpha3, beta2, and beta4 subunits. Assembly of human neuronal nicotinic receptor alpha5 subunits with alpha3, beta2, and beta4 subunits. The Journal of biological chemistry 1996 imex curation Wang F., Gerzanich V., Wells GB., Anand R., Peng X., Keyser K., Lindstrom J. Only protein-protein interactions imex curation xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang F., Gerzanich V., Wells GB., Anand R., Peng X., Keyser K., Lindstrom J. Accepted 2015-APR-30 by ORCHARD The Journal of biological chemistry 1996 Only protein-protein interactions imex curation imex curation acha5_human Neuronal acetylcholine receptor subunit alpha-5 CHRNA5 NACHRA5 protein protein human Homo sapiens Human MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK 7FE91A2E362289C0 achb2_human Neuronal acetylcholine receptor subunit beta-2 CHRNB2 protein protein human Homo sapiens Human MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTTFLHSDHSAPSSK 7EEDEF6ADFDC9F23 acha3_human Neuronal acetylcholine receptor subunit alpha-3 CHRNA3 NACHRA3 protein protein human Homo sapiens Human MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA 478D7712D59ACB2D chrnb2-chrna5-1 3 4 unspecified role unspecified role prey prey tag epitope SQVTGEVIFQTPLIKNPLQQVTGEVIFQTPLIKNPLQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait physical association physical association Fig. 7a (lanes 5&6) chrna5-chrna3-1 1 4 unspecified role unspecified role bait bait tag epitope SQVTGEVIFQTPLIKNPLQQVTGEVIFQTPLIKNPLQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Fig. 7a (lanes 9, 12 & 14) beta2 is required for this interaction as without it, alpha3 is not detected (lane 10). chrnb2-chrna3-1 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association Fig 7b (lanes 2 & 3)