IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Mol. Cell. Biol. (0270-7306) 1996 imex curation Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Only protein-protein interactions mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Accepted 2015-FEB-27 by MGT Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Mol. Cell. Biol. (0270-7306) 1996 imex curation Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. I made CHOP (ddit3) rat as the ser107 matches rat and not human. The paper seemed ambiguous... rond01@saturn.med.nyu.edu Accepted 2015-FEB-27 by MGT Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Mol. Cell. Biol. (0270-7306) 1996 imex curation Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Accepted 2015-MAR-05 by MGT Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. Mol. Cell. Biol. (0270-7306) 1996 imex curation Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Accepted 2015-MAR-05 by MGT Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation cebpb_rat CCAAT/enhancer-binding protein beta Cebpb Crp2 Sfb C/EBP-related protein 2 Interleukin-6-dependent-binding protein Liver-enriched transcriptional activator Silencer factor B Nf-il6 Liver-enriched inhibitory protein protein protein rat Rattus norvegicus (Rat) Rat MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC C2511FDB65527789 cebpa_rat CCAAT/enhancer-binding protein alpha Cebpa protein protein rat Rattus norvegicus (Rat) Rat MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA 4DA8F112F6EA95D0 ddit3_mouse DNA damage-inducible transcript 3 protein Ddit3 Chop Chop10 Gadd153 C/EBP zeta C/EBP-homologous protein C/EBP-homologous protein 10 CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA-damage-inducible protein GADD153 protein protein mouse Mus musculus Mouse MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA DIP protein P35639 original sequence version: 112 CA423B79512F33AB cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC DIP protein P17676 original sequence version: 102 9B725BD6CCAA771D ddit3_rat DNA damage-inducible transcript 3 protein Ddit3 Chop Chop10 Gadd153 C/EBP zeta C/EBP-homologous protein C/EBP-homologous protein 10 CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA-damage-inducible protein GADD153 protein protein rat Rattus norvegicus (Rat) Rat MAAESLPFAFETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPAEVTSTSQSPRSPDSSQSSMAQEEEEEDQGRTRKRKQSGQCAARAGKQRMKEKEQENERKVAQLAEENERLKLEIERLTREVETTRRALIDRMVSLHQA 251716CD712BA6E1 camre calmodulin-responsive element ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) AAATGTAGTCTTATGCAATACACTTGTAGTCTTGCAACA cebpb-ddit3-1 4 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait bzip_domain sufficient to bind sufficient binding region sufficient to bind range range range range 32p tag on ser12 of a-kinase box tag 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined a-kinase box tag (merreilsrrpsyrkd) tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 1a (lane 2) ddit3-cebpa-1 2 6 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 304-358 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32p tag 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2a (blot 2) Methods say that the C/EBPalpha fragment is 304-359 but the protein is only 358 long, even in the uniprot history files back to 1988 and uniprot HAS the starting Met. ddit3-cebpb-1 2 9 unspecified role unspecified role bait bait 32p tag 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 294-345 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 2a (blot 1) camre-cebpb-2 3 8 unspecified role unspecified role prey prey bzip domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait 32p label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) physical association physical association Fig. 6a I made made the proteins rat in accordance with other experiements althought it's not entirely clear for this figure. camre-cebpb-3 1 10 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey physical association physical association Fig. 6c (lane 3) Supershifted with monoclonal antibody 3H8 against CHOP (ddit3).