IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Purification of a cytochrome bd terminal oxidase encoded by the Escherichia coli app locus from a delta cyo delta cyd strain complemented by genes from Bacillus firmus OF4. Purification of a cytochrome bd terminal oxidase encoded by the Escherichia coli app locus from a delta cyo delta cyd strain complemented by genes from Bacillus firmus OF4. Journal of bacteriology 1996 imex curation Sturr MG., Krulwich TA., Hicks DB. Hicks@msvax.mssm.edu 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) chromatography chromatography technology column chromatography chromatography edman degradation edman degradation Sturr MG., Krulwich TA., Hicks DB. A detergent extract from washed everted membrane vesicles were subject to sequential ultra-centrifugation, ammonium-sulphate centrifugation, hydroxy-apatite, ion-exchange and gel filtration chromatography. The N terminus of appC was blocked, therefore the identity of this protein was confirmed through sequencing of an internal peptide. Hicks@msvax.mssm.edu Accepted 2015-SEP-22 AT 10:35 BST AT 10:35 BST by MGT Journal of bacteriology 1996 Only protein-protein interactions imex curation imex curation appb_ecoli Cytochrome bd-II ubiquinol oxidase subunit 2 Cytochrome bd-II oxidase subunit II appB cbdB cyxB b0979 JW0961 protein protein ecoli Escherichia coli (strain K12) MFDYETLRFIWWLLIGVILVVFMISDGFDMGIGCLLPLVARNDDERRIVINSVGAHWEGNQVWLILAGGALFAAWPRVYAAAFSGFYVAMILVLCSLFFRPLAFDYRGKIADARWRKMWDAGLVIGSLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGSFWQLLTPFPLLCGLLSLGMVILQGGVWLQLKTVGVIHLRSQLATKRAALLVMLCFLLAGYWLWVGIDGFVLLAQDANGPSNPLMKLVAVLPGAWMNNFVESPVLWIFPLLGFFCPLLTVMAIYRGRPGWGFLMASLMQFGVIFTAGITLFPFVMPSSVSPISSLTLWDSTSSQLTLSIMLVIVLIFLPIVLLYTLWSYYKMWGRMTTETLRRNENELY 8184B10C47660002 appc_ecoli Cytochrome bd-II ubiquinol oxidase subunit 1 appC cbdA cyxA b0978 Cytochrome bd-II oxidase subunit I JW0960 protein protein ecoli Escherichia coli (strain K12) MWDVIDLSRWQFALTALYHFLFVPLTLGLIFLLAIMETIYVVTGKTIYRDMTRFWGKLFGINFALGVATGLTMEFQFGTNWSFYSNYVGDIFGAPLAMEALMAFFLESTFVGLFFFGWQRLNKYQHLLVTWLVAFGSNLSALWILNANGWMQYPTGAHFDIDTLRMEMTSFSELVFNPVSQVKFVHTVMAGYVTGAMFIMAISAWYLLRGRERNVALRSFAIGSVFGTLAIIGTLQLGDSSAYEVAQVQPVKLAAMEGEWQTEPAPAPFHVVAWPEQDQERNAFALKIPALLGILATHSLDKPVPGLKNLMAETYPRLQRGRMAWLLMQEISQGNREPHVLQAFRGLEGDLGYGMLLSRYAPDMNHVTAAQYQAAMRGAIPQVAPVFWSFRIMVGCGSLLLLVMLIALVQTLRGKIDQHRWVLKMALWSLPLPWIAIEAGWFMTEFGRQPWAIQDILPTYSAHSALTTGQLAFSLIMIVGLYTLFLIAEVYLMQKYARLGPSAMQSEQPTQQQG 2D2FBD43429D960D appb-appc-1 1 3 partial id prot seq partial identification of protein sequence partial id prot seq edman degradation edman degradation unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component physical association physical association Table 2