UniProt UniProt http://www.uniprot.org Recruitment of VPS33A to HOPS by VPS16 is required for lysosome fusion with endosomes and autophagosomes. Recruitment of VPS33A to HOPS by VPS16 is required for lysosome fusion with endosomes and autophagosomes. Traffic (Copenhagen, Denmark) 2015 imex curation Wartosch L., Günesdogan U., Graham SC., Paul Luzio J. jpl10@cam.ac.uk Only protein-protein interactions human-helam Homo sapiens epitheloid cervix carcinoma cells, HelaM variant cell line Human helam HelaM variant cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wartosch L., Günesdogan U., Graham SC., Paul Luzio J. jpl10@cam.ac.uk Accepted 2015-JUN-04 by ORCHARD Traffic (Copenhagen, Denmark) 2015 IMEx imex curation Recruitment of VPS33A to HOPS by VPS16 is required for lysosome fusion with endosomes and autophagosomes. Recruitment of VPS33A to HOPS by VPS16 is required for lysosome fusion with endosomes and autophagosomes. Traffic (Copenhagen, Denmark) 2015 imex curation Wartosch L., Günesdogan U., Graham SC., Paul Luzio J. jpl10@cam.ac.uk Only protein-protein interactions human-helam Homo sapiens epitheloid cervix carcinoma cells, HelaM variant cell line Human helam HelaM variant cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wartosch L., Günesdogan U., Graham SC., Paul Luzio J. jpl10@cam.ac.uk Accepted 2015-JUN-04 by ORCHARD Traffic (Copenhagen, Denmark) 2015 IMEx imex curation Recruitment of VPS33A to HOPS by VPS16 is required for lysosome fusion with endosomes and autophagosomes. Recruitment of VPS33A to HOPS by VPS16 is required for lysosome fusion with endosomes and autophagosomes. Traffic (Copenhagen, Denmark) 2015 imex curation Wartosch L., Günesdogan U., Graham SC., Paul Luzio J. jpl10@cam.ac.uk Only protein-protein interactions human-helam Homo sapiens epitheloid cervix carcinoma cells, HelaM variant cell line Human helam HelaM variant cell line anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wartosch L., Günesdogan U., Graham SC., Paul Luzio J. jpl10@cam.ac.uk Accepted 2015-JUN-04 by ORCHARD Traffic (Copenhagen, Denmark) 2015 IMEx imex curation vp33a_human Vacuolar protein sorting-associated protein 33A VPS33A protein protein human Homo sapiens Human MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF 12442A1D9A223F56 vps16_human Vacuolar protein sorting-associated protein 16 homolog VPS16 protein protein human Homo sapiens Human MDCYTANWNPLGDSAFYRKYELYSMDWDLKEELRDCLVAAAPYGGPIALLRNPWRKEKAASVRPVLDIYSASGMPLASLLWKSGPVVSLGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAHRFTLSANVGDLKLRRMPEVPGLQSAPSCWTVLCQDRVAHILLAVGPDLYLLDHAACSAVTPPGLAPGVSSFLQMAVSFTYRHLALFTDTGYIWMGTASLKEKLCEFNCNIRAPPKQMVWCSRPRSKERAVVVAWERRLMVVGDAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPAASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREIQELGQLTQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVHMCQDLRVLNAVRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK 9C4292D455C19A60 vps18_human Vacuolar protein sorting-associated protein 18 homolog VPS18 KIAA1475 protein protein human Homo sapiens Human MASILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKVHKMFLDHTGSHLLIALSSTEVLYVNRNGQKVRPLARWKGQLVESVGWNKALGTESSTGPILVGTAQGHIFEAELSASEGGLFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRSFVIATTRQRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFLEKFGPLKHMVKDSSTGQLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPDCLDTVLAREADFCFRQRRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLASLKPAERTQATLLTTWLTELYLSRLGALQGDPEALTLYRETKECFRTFLSSPRHKEWLFASRASIHELLASHGDTEHMVYFAVIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSPILIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGEVQQVSQAIRYMEFCVNVLGETEQAIHNYLLSLYARGRPDSLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVLELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASCPLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQELRGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQRKLGAAPPPAKGSARAKEAEGGAATAGPSREQLKADLDELVAAECVYCGELMIRSIDRPFIDPQRYEEEQLSWL 0008E21D66E8CFEC vp33b_human Vacuolar protein sorting-associated protein 33B VPS33B protein protein human Homo sapiens Human MAFPHRPDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQHEVDKLYKVENKPALSSNEQLCFLVRPRIKNMRYIASLVNADKLAGRTRKYKVIFSPQKFYACEMVLEEEGIYGDVSCDEWAFSLLPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMAYELWRNLEEEEDGETKGRRPEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIKCGSVDFGPEVTSSDKSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKEDKASSESLRLILVVFLGGCTFSEISALRFLGREKGYRFIFLTTAVTNSARLMEAMSEVKA BD7DB97E1FEB1D32 spe39_human Spermatogenesis-defective protein 39 homolog VIPAS39 C14orf133 SPE39 VIPAR VPS33B-interacting protein in apical-basolateral polarity regulator VPS33B-interacting protein in polarity and apical restriction protein protein human Homo sapiens Human MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPDKRKEFLKTCVGLPFSAEDSAHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIDALLSSSQIRWKN CF05C38EB922D192 vps16-vps18-1 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2D vps18-vps33a-1 3 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96AX1:p.[Lys429Asp;Ile441Lys] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain I K Fri Jul 22 11:13:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 19:27:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys429asp,ile441lys' Tue Jun 30 18:29:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys429Asp;Ile441Lys]' Q96AX1:p.[Tyr438Asp;Ile441Lys] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y D certain certain sequence position certain certain certain sequence position certain I K Fri Jul 22 11:13:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 15:06:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr438asp,ile441lys' Tue Jun 30 17:01:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr438Asp;Ile441Lys]' Q96AX1:p.[Lys429Asp;Tyr438Asp] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain Y D Fri Jul 22 11:01:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 17:18:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys429asp,tyr438asp' Tue Jun 30 17:28:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys429Asp;Tyr438Asp]' 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association 3D vps18-vps33a-2 3 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait physical association physical association 6A vps18-vps16-1 3 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait physical association physical association 6A vps16-vps18-2 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6A vps33a-vps18-2 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6A vps33b-vipas39-1 1 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6B vipas39-vps33b-3 1 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6B vps16-vps18-8 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9H269:p.Ala669Asp mutation mutation certain certain sequence position certain certain certain sequence position certain A D Disrupts association with VPS33A and decreases association with VPS18 Wed May 02 15:18:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala669asp' Tue Jun 30 17:31:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala669Asp' Q9H269:p.Arg725Glu mutation mutation certain certain sequence position certain certain certain sequence position certain R E Disrupts association with VPS33A and decreases association of VPS18 Wed May 02 16:23:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg725glu' Tue Jun 30 20:07:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg725Glu' physical association physical association 2D