UniProt UniProt http://www.uniprot.org ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. Human molecular genetics 2015 imex curation Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Accepted 2015-NOV-26 AT 08:37 GMT AT 08:37 GMT by ORCHARD human fetal brain cDNA Human molecular genetics 2015 IMEx imex curation ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. Human molecular genetics 2015 imex curation Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Accepted 2015-NOV-26 AT 08:37 GMT AT 08:37 GMT by ORCHARD Human molecular genetics 2015 IMEx imex curation ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. Human molecular genetics 2015 imex curation Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Accepted 2015-NOV-26 AT 08:37 GMT AT 08:37 GMT by ORCHARD Human molecular genetics 2015 IMEx imex curation ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. Human molecular genetics 2015 imex curation Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Accepted 2015-NOV-26 AT 08:37 GMT AT 08:37 GMT by ORCHARD human fetal brain cDNA Human molecular genetics 2015 IMEx imex curation ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. Human molecular genetics 2015 imex curation Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Accepted 2015-NOV-26 AT 08:37 GMT AT 08:37 GMT by ORCHARD Human molecular genetics 2015 IMEx imex curation ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1. Human molecular genetics 2015 imex curation Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Accepted 2015-NOV-26 AT 08:37 GMT AT 08:37 GMT by ORCHARD Human molecular genetics 2015 IMEx imex curation roa1_human Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 HNRPA1 Helix-destabilizing protein Single-strand RNA-binding protein hnRNP core protein A1 protein protein human Homo sapiens Human MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF DIP protein P09651 original sequence version: 176 A06683571C6C109F roa3_human Heterogeneous nuclear ribonucleoprotein A3 HNRPA3 HNRNPA3 protein protein human Homo sapiens Human MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF 832372C4C29547B1 ubql1_human Ubiquilin-1 Protein linking IAP with cytoskeleton 1 UBQLN1 DA41 PLIC1 protein protein human Homo sapiens Human MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS 8B4756B6113B7025 p09651-2 Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 HNRPA1 Helix-destabilizing protein Single-strand RNA-binding protein hnRNP core protein A1 protein protein human Homo sapiens Human MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF DIP protein P09651-2 original sequence version: 107 DIP protein P09651-2 original sequence version: 179 Is twenty times more abundant than isoform A1-B. 59485C9FA1FF8AE1 hnrpu_human Heterogeneous nuclear ribonucleoprotein U HNRNPU SAFA U21.1 HNRPU p120 pp120 C1orf199 GRIP120 Nuclear p120 ribonucleoprotein Scaffold-attachment factor A protein protein human Homo sapiens Human MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRSGAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY DIP protein Q00839 original sequence version: 122 5D4EC4188436831F ubql2_human Ubiquilin-2 UBQLN2 PLIC2 HRIHFB2157 N4BP4 Protein linking IAP with cytoskeleton 2 Ubiquitin-like product Chap1/Dsk2 DSK2 homolog Chap1 protein protein human Homo sapiens Human MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS DIP protein Q9UHD9 original sequence version: 108 DIP protein Q9UHD9 original sequence version: 113 DF7DF8C4D7B71AC3 ubqln2-hnrnpa1-1 4 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 17 physical association physical association 1A and B ubqln2-hnrnpa3-1 4 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 20 22 physical association physical association 1A and B ubqln2-hnrnpu-1 4 11 unspecified role unspecified role prey prey N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 27 25 physical association physical association 1A and B ubqln2-hnrnpa1-2 1 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P H UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Wed May 02 16:01:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497his' Tue Jun 30 17:54:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497His' Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656 Wed May 02 17:20:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497ser' Tue Jun 30 18:07:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497Ser' Q9UHD9:p.Pro506Thr mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain P T UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564. Wed May 02 14:53:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro506thr' Tue Jun 30 17:38:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro506Thr' Q9UHD9:p.Pro509Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565. Wed May 02 15:31:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro509ser' Tue Jun 30 18:55:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro509Ser' Q9UHD9:p.Pro525Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566. Wed May 02 18:35:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro525ser' Tue Jun 30 17:30:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro525Ser' physical association physical association 2A ubqln2-hnrnpa1-3 1 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P H UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Wed May 02 20:21:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497his' Tue Jun 30 17:37:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497His' Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656. Wed May 02 20:08:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497ser' Tue Jun 30 17:44:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497Ser' Q9UHD9:p.Pro506Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P T UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564. Wed May 02 19:35:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro506thr' Tue Jun 30 19:43:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro506Thr' Q9UHD9:p.Pro509Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565. Wed May 02 16:39:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro509ser' Tue Jun 30 15:43:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro509Ser' Q9UHD9:p.Pro525Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566. Wed May 02 16:42:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro525ser' Tue Jun 30 19:12:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro525Ser' physical association physical association 2A ubqln2-hnrnpu-3 1 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P H UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Wed May 02 19:06:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497his' Tue Jun 30 19:47:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497His' Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656. Wed May 02 19:13:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497ser' Tue Jun 30 16:12:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497Ser' Q9UHD9:p.Pro506Thr mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain P T UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564 Wed May 02 19:32:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro506thr' Tue Jun 30 17:26:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro506Thr' Q9UHD9:p.Pro509Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565. Wed May 02 17:27:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro509ser' Tue Jun 30 16:18:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro509Ser' Q9UHD9:p.Pro525Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566. Wed May 02 15:36:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro525ser' Tue Jun 30 15:44:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro525Ser' physical association physical association 2c ubqln2-hnrnpu-2 5 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 12 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3A and B ubqln1-hnrnpa1-2 5 9 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association 3A and B ubqln2-hnrnpa1-5 5 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 12 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3A and B ubqln2-hnrnpa1-4 2 12 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P09651-2:p.Asp262Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D V HNRNPA1 disease variant found in inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3 (IBMPFD3; MIM:615424; UniProt FTId: VAR_070589. Wed May 02 15:43:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp262val' Tue Jun 30 15:46:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp262Val' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3C and D, 5B ubqln2-hnrnpa1-8 6 7 unspecified role unspecified role prey prey cell lysate cell lysate 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P H UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Wed May 02 15:01:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497his' Tue Jun 30 18:03:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497His' Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656. Wed May 02 19:04:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro497ser' Tue Jun 30 16:12:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro497Ser' undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564 Wed Jul 06 17:11:55 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'pro506thr' undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565 Wed Jul 06 17:11:55 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'pro509ser' Q9UHD9:p.Pro525Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566 Wed May 02 20:30:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro525ser' Tue Jun 30 16:59:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro525Ser' physical association physical association 4B, 4C and D, supplement. S2 and S4 ubqln2-hnrnpa1-7 3 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4B