IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling. A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling. Cancer cell 2014 imex curation Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer please check annotations actually refer to the experimental conditions used (CHIP) also that all interactions have Bait/Prey roles; annotations seem to alter randomly to previous versions, and roles disappear or revert to top/bottom of the list. I have spotted most - I think- but may have missed some (or they have altered subsequently). pierre.vanderhaeghen@ulb.ac.be Only protein-protein interactions imex curation mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer please check annotations actually refer to the experimental conditions used (CHIP) also that all interactions have Bait/Prey roles; annotations seem to alter randomly to previous versions, and roles disappear or revert to top/bottom of the list. I have spotted most - I think- but may have missed some (or they have altered subsequently). pierre.vanderhaeghen@ulb.ac.be Accepted 2015-JUN-15 by ORCHARD Cancer cell 2014 Only protein-protein interactions imex curation imex curation added a causality statement for 2 interactions only A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling. A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling. Cancer cell 2014 imex curation Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer please check annotations actually refer to the experimental conditions used (CHIP) also that all interactions have Bait/Prey roles; annotations seem to alter randomly to previous versions, and roles disappear or revert to top/bottom of the list. I have spotted most - I think- but may have missed some (or they have altered subsequently). pierre.vanderhaeghen@ulb.ac.be Only protein-protein interactions imex curation human-daoy Homo sapiens DAOY cerebellar medulloblastoma cell line daoy DAOY cerebellar medulloblastoma cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer please check annotations actually refer to the experimental conditions used (CHIP) also that all interactions have Bait/Prey roles; annotations seem to alter randomly to previous versions, and roles disappear or revert to top/bottom of the list. I have spotted most - I think- but may have missed some (or they have altered subsequently). pierre.vanderhaeghen@ulb.ac.be Accepted 2015-JUN-15 by ORCHARD Cancer cell 2014 Only protein-protein interactions imex curation imex curation added a causality statement for 2 interactions only A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling. A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling. Cancer cell 2014 imex curation Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer please check annotations actually refer to the experimental conditions used (CHIP) also that all interactions have Bait/Prey roles; annotations seem to alter randomly to previous versions, and roles disappear or revert to top/bottom of the list. I have spotted most - I think- but may have missed some (or they have altered subsequently). pierre.vanderhaeghen@ulb.ac.be Only protein-protein interactions imex curation mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tiberi L., Bonnefont J., van den Ameele J., Le Bon SD., Herpoel A., Bilheu A., Baron BW., Vanderhaeghen P. Cancer - Interactions investigated in the context of cancer The Supplementary Methods for "Western Blot, CoIP, ChIP, ChIP Quantitative PCR" states:- "Cerebellar cells and DAOY cells were fixed with 1% formaldehyde for 15 min at room temperature". This cross-linking has been assumed to apply to the ChIp protocol only, rather than for Western Blots and CoIPs. please check annotations actually refer to the experimental conditions used (CHIP) also that all interactions have Bait/Prey roles; annotations seem to alter randomly to previous versions, and roles disappear or revert to top/bottom of the list. I have spotted most - I think- but may have missed some (or they have altered subsequently). pierre.vanderhaeghen@ulb.ac.be Accepted 2015-JUN-15 by ORCHARD Cancer cell 2014 Only protein-protein interactions imex curation imex curation added a causality statement for 2 interactions only atoh1_mouse_gene Protein atonal homolog 1 gene gene mouse Mus musculus Mouse sir1_mouse NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 Sirt1 Sir2l1 SIR2alpha SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein mouse Mus musculus Mouse MADEVALALQAAGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWREAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDEGEEEDEAAAAAAAAAIGYRDNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAVGSSTADKNERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADGGDQEVVNEAIATRQELTDVNYPSDKS DIP protein Q923E4 original sequence version: 83 DIP protein Q923E4 original sequence version: 135 7F15625E29433119 gli1_human_gene Zinc finger protein GLI1 GLI1 GLI gene gene human Homo sapiens Human bcor_human BCL-6 corepressor BCOR KIAA1575 protein protein human Homo sapiens Human MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDASTAHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNPEMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLNINGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVDSHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPAADTYSEFHKHYARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKDGSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGSEIPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQRSSSCPRMGGTDAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQPPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPPIPYPRSYLPYPAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILETSSTKLHPDVPTDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKPSVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPFLEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPSKLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAMMRFSELEMKEREGGHPATKDSEMCKFSPADWERLKGNQDKKPKSVTLEEAIAEQNESERCEYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQVASDMPHSPTLRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRKRAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAKQQKIKENQKTDVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLTGEYYVENADGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW A80CFCD5618EE717 bcor_mouse BCL-6 corepressor Bcor Kiaa1575 protein protein mouse Mus musculus Mouse MLSATPLYGNVHSWMNSERVRMCGTSEDRKIPVNDGDASKARLELREETPLSHSVVDTSGAHRIDGLAALSMDRTGLIREGLRVPGNIVYSGLCGLGSEKGREATPSSLSGLGFSSERNPEMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAESLGLDRPASDKQSPLNINGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYGLAQPLYSPVCTSGERFLYLPPPHYVNPHIPSSLASPMRLSTPSASAAIPPLVHCSDKSLPWKMGVNPGNPVDSHSYPHIQNSKQPRVTSAKAVNSGLPGDTALLLPPSPRPSARVHLPTQPAAETYSEFHKHYPRISTSPSVTLTKPYMTANSEFSTSRLSNGKYPKALDGGDCAQSMPGHTRKTTVQDRKDGGSPPLLEKQTVTKDVTDKPLDLSSKVVDADASKGDHMKKMAPTVLVHSRAASGLVLSGSEIPKETLSPPGNGCSIYRSEIISTAPSSWVVPGPSPNEENNGKSLSLKNKALDWAIPQQRSSSCPRMGGTDAVVTNVSGSVSSSGRPASASPAPNANANADGTKTSRSSVDTTPSVIQHVGQPSSTPAKHGGSTSSKGAKANPEPSFKASENGLPPTSIFLSPNEAFRSPAIPYPRSYLPYAAPEGIALSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLHTSRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRSRFSEMLEASSTKLHPEVPTDKNLKPNSSWNQGKTGVKSDKLVYVDLLREEADTKTDAGAPKAGLVAENVGQDTEATKPSADPVIQQRREFISLREELGRITDFHESFTFKQASSQPVFSLGKDSGAAGTNKENLGVQVATPFLETALGSEGPAVTFGKTQEDPKPFCVGGAPPNMDVTPAYTKEGTDEAESNDGKVLKPKPSKLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAMMRFSELEMKEREGSHPATKDSEVCKFSPADWERLKGNQEKKPKSVTLEEAIADQNDSERCEYSTGNKHDLFEAPEDKDLPVEKYFLERPPVSEPPSDQGVVDTPHSPTLRLDRKRKLSGDSTHTETAVEELAEDPLKAKRRRISKDDWPEREMTNSSSNHLEDPHCNELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAAESKPGRQSRKEVAQAVQPEVTSQGTNITEEKPGRKKAEAKGNRGWSEESLKSCDNEQGLPVLSGSPPMKSLSSTNASGKKQTQPSCTPASRLPAKQQKIKESQKTDVLCTGEDEDCQAASPLQKYTDNIEKPSGKRLCKTKHLIPQESRRSLQITGDYYVENTDTKMTVRRFRKRPEPSSDYDLSPPAKQEPKPFDRLQQLLPATQATQLPRSNSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKVCDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRSEDDTSGAWEFYGSSVCEPDDESGYDVLANPPGPEDPDEEEDTYSDLFEFEFAESSLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNLEIVTIAEAEFYRQVSTSLLFSCPKDLEAFNPESKELLDLVEFTNELQTLLGSSVEWLHPSDTGHENYW DIP protein Q8CGN4 original sequence version: 45 C7FF21CFB3C60D49 atoh1_human_gene Protein atonal homolog 1 ATOH1 ATH1 BHLHA14 gene gene human Homo sapiens Human h14_human Histone H1.4 H1-4 H1F4 HIST1H1E Histone H1b Histone H1s-4 protein protein human Homo sapiens Human MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAKPKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK 1720FECCCBEBCC7F h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 gli1_mouse_gene Zinc finger protein GLI1 Gli1 Gli gene gene mouse Mus musculus Mouse bcl6_mouse B-cell lymphoma 6 protein homolog Bcl6 Bcl-6 protein protein mouse Mus musculus Mouse MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEISPEGFCILLDFMYTSRLNLREGNIMAVMTTAMYLQMEHVVDTCRKFIKASEAEMAPALKPPREEFLNSRMLMPHDIMAYRGREVVENNMPLRNTPGCESRAFAPPLYSGLSTPPASYPMYSHLPLSTFLFSDEELRDAPRMPVANPFPKERALPCDSARQVPNEYSRPAMEVSPSLCHSNIYSPKEAVPEEARSDIHYSVPEGPKPAVPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGSEQAELGRLSPRAYPAPPACQPPMEPANLDLQSPTKLSASGEDSTIPQASRLNNLVNRSLAGSPRSSSESHSPLYMHPPKCTSCGSQSPQHTEMCLHTAGPTFPEEMGETQSEYSDSSCENGTFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSAADLPPELPKAC DIP protein P41183 original sequence version: 102 2051DD808D32D5EC gli2_mouse_gene Mouse GLI2 gene gene gene mouse Mus musculus Mouse h14_mouse Histone H1.4 H1-4 H1 VAR.2 H1e H1f4 Hist1h1e protein protein mouse Mus musculus Mouse MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKRAGAAKAKKPAGAAKKPKKAAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAKKK 9463467F699F3625 hes5_mouse_gene Mouse Hes5 gene gene gene mouse Mus musculus Mouse h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62806 original sequence version: 108 A9E5DFD3F8B97598 gli2_human_gene Human Gli2 Gene gene gene human Homo sapiens Human hes5_human_gene Transcription factor HES-5 HES5 BHLHB38 gene gene human Homo sapiens Human sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F bcl6-gli1-1 1 12 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association 3B Little binding was observed using Bcl6 KO mice. bcl6-gli2_mouse_gene-2 1 14 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association 3B-2 Little binding was observed using Bcl6 KO mice. sirt1-gli2_mouse_gene-1 1 14 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association 3C Reduced binding was observed using Bcl6 KO mice. sirt1-gli1-1 1 12 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association 3C Reduced binding was observed using Bcl6 KO mice. sirt1-hes5_mouse_gene-1 1 16 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association 3Ci No significant reduction of binding was observed using Bcl6 KO mice. sirt1-atoh1_mouse_gene-1 1 4 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association 3Cii No significant reduction in binding was observed using Bcl6 KO mice. hist1h1e-atoh1_mouse_gene-1 1 4 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 3D No significant reduction in binding was observed using Bcl6 KO mice. sirt1-gli1-2 1 12 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 3D Increased binding was observed using Bcl6 KO mice. hist1h1e-gli2_mouse_gene-1 1 14 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 3D Increased binding was observed using Bcl6 KO mice. hist1h1e-gli2_mouse_gene-2 1 14 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 3E Increased binding was observed using Bcl6 KO mice. sirt1-gli1-3 1 12 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 3E Increased binding was observed using Bcl6 KO mice. bcl6-gli1-2 1 12 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 3F Little binding was observed using Bcl6 KO mice. bcl6-gli2_mouse_gene-1 1 14 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association 3F Little binding was observed using Bcl6 KO mice. hist1h1e-gli2_human_gene-1 2 18 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4J Decreased binding to the Intron1 region was observed using Bcl6 transfected cells;however both transfected and non-transfected cells showed significant binding to the proximal promoter regions. bcl6-gli2_human_gene-1 2 18 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association 4G Increased binding was seen using Bcl6 transfected cells. P41183 decreases expression at RNA level of ENSG00000074047 sirt1-hes5_mouse_gene-2 2 19 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association 4I A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. sirt1-gli1-4 2 6 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association 4I Increased binding was seen using Bcl6 transfected cells. sirt1-gli2_mouse_gene-2 2 18 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association 4I Increased binding was seen using Bcl2 transfected cells. hist1h1e-gli1-1 2 6 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4J Decreased binding was observed using Bcl6 transfected cells. hist1h4a-gli1-1 2 6 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4K Decreased binding was seen using Bcl6 transfected cells. bcl6-gli1-3 2 6 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait association association 4G An increase in binding was seen using Bcl6 transfected cells. P41183 decreases expression at RNA level of ENSG00000111087 bcor-gli1-1 2 6 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association 4H Increased binding was seen using Bcl6 transfected cells. bcor-gli2_mouse_gene-1 2 18 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association 4H Increased binding was seen using Bcl6 transfected cells. hist1h1e-atoh1-1 2 9 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4J A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. hist1h4a-atoh1-1 2 9 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4K A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. hist1h1e-hes5-1 2 19 unspecified role unspecified role prey prey promoter_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4J A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. hist1h4a-gli2_human_gene-1 2 18 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4K Using Bcl6 transfected cells decreased binding was seen at the Intron 1 binding region;however at the proximal promoter binding regions an increase in binding above background was seen for both Bcl6 transfected and non-transfected cells, with no significant difference in binding between the cells. hist1h4a-hes5-1 2 19 unspecified role unspecified role prey prey intron_1_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait N/A naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain association association 4K A slight increase in binding above background was seen for both Bcl6 transfected and non-transfected cells; however there was no significant difference in binding between these cells. sirt1-bcl6-2 3 13 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Supp Fig 3A sirt1-bcl6-1 3 13 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Supp Fig 3B bcor-bcl6-1 3 5 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Supp Fig 3C This interaction did not occur in Bcl6 KO mice cells.