MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. FEBS Lett. (0014-5793) 2014 imex curation Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr Accepted 2015-FEB-11 by LUANA FEBS Lett. (0014-5793) 2014 Only protein-protein interactions imex curation PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. FEBS Lett. (0014-5793) 2014 imex curation Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr Accepted 2015-FEB-11 by LUANA FEBS Lett. (0014-5793) 2014 Only protein-protein interactions imex curation PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. FEBS Lett. (0014-5793) 2014 imex curation Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr Accepted 2015-FEB-11 by LUANA FEBS Lett. (0014-5793) 2014 Only protein-protein interactions imex curation PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas. FEBS Lett. (0014-5793) 2014 imex curation Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee J.H., Lee J.Y., Rho S.B., Choi J.S., Lee D.G., An S., Oh T., Choi D.C., Lee S.H. shlee@yongin.ac.kr Accepted 2015-FEB-11 by LUANA FEBS Lett. (0014-5793) 2014 Only protein-protein interactions imex curation clus_human Clusterin CLU APOJ CLI KUB1 Complement-associated protein SP-40,40 Complement cytolysis inhibitor NA1/NA2 Apolipoprotein J Testosterone-repressed prostate message 2 Ku70-binding protein 1 Aging-associated gene 4 protein AAG4 Sulfated glycoprotein 2 protein protein human Homo sapiens Human MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE DIP protein P10909 original sequence version: 151 9583DE4CCECC169F paca_human Pituitary adenylate cyclase-activating polypeptide ADCYAP1 protein protein human Homo sapiens Human MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL DIP protein P18509 original sequence version: 128 mint Stimulates adenylate cyclase in pituitary cells 696DD57D2A510E1D adcyap1-clu-1 4 6 predetermined predetermined participant predetermined nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey cdna library cdna library physical association physical association nf adcyap1-clu-2 3 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f2a f2b f3a f3b clu-adcyap1 1 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2c adcyap1-clu-3 2 6 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f2d