IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-bmdm Mus musculus bmdm bone marrow-derived macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro biochemical biochemical anti tag western anti tag western blot anti tag western Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. Fe(III) (S)-1-(p-Bromoacetamido-benzyl)ethylene diamine tetraacetic acid (FeBABE) was attached via its bromoacetyl group to sulfhydryl sites of S100A8 bearing cysteine mutations at 10-amino acid intervals. When activated by ascorbate and peroxide, the Fe(III) EDTA group will cleave peptide bonds of the prey protein, acting as an artificial protease. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Target-selective protein S-nitrosylation by sequence motif recognition. Target-selective protein S-nitrosylation by sequence motif recognition. Cell (0092-8674) 2014 imex curation Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. foxp@ccf.org 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. GAPDH was labeled with Alexa Fluro 546-C5-maleimide and 647-C5-maleimide, change in FRET signal on S100A8 addition was taken as indicative of binding. foxp@ccf.org Accepted 2015-FEB-05 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 rl13a_mouse 60S ribosomal protein L13a Transplantation antigen P198 Tum-P198 antigen Rpl13a P198 Tstap198-7 protein protein mouse Mus musculus Mouse MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV 967AEAE3362E02CC mpcp_human Phosphate carrier protein, mitochondrial SLC25A3 PHC OK/SW-cl.48 Phosphate transport protein Solute carrier family 25 member 3 protein protein human Homo sapiens Human MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ 78714C85931B22D5 78714C85931B22D5 g3p_human Glyceraldehyde-3-phosphate dehydrogenase GAPDH OK/SW-cl.12 CDABP0047 GAPD Peptidyl-cysteine S-nitrosylase GAPDH protein protein human Homo sapiens Human MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE DIP protein P04406 original sequence version: null DIP protein P04406 original sequence version: 196 DIP protein P04406 original sequence version: 198 DIP protein P04406 original sequence version: 156 C9C135E8AE3E8744 s10a8_human Protein S100-A8 S100A8 CAGA MRP8 CFAG S100 calcium-binding protein A8 Calgranulin-A Migration inhibitory factor-related protein 8 Cystic fibrosis antigen Leukocyte L1 complex light chain Calprotectin L1L subunit Urinary stone protein band A protein protein human Homo sapiens Human MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE 78F589140B9CE166 nos2_human Nitric oxide synthase, inducible NOS2 NOS2A Hepatocyte NOS Inducible NO synthase NOS type II Peptidyl-cysteine S-nitrosylase NOS2 protein protein human Homo sapiens Human MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYGRFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINIAVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEMLNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGDELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQLLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQLPILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCFVRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPDEDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAVQPSSLEMSAL DIP protein P35228 original sequence version: 140 47671E5385CB3A52 lysc_human Lysozyme C LYZ LZM 1,4-beta-N-acetylmuramidase C protein protein human Homo sapiens Human MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV 8ECFD276BEB2678A g3p_mouse Glyceraldehyde-3-phosphate dehydrogenase Gapdh Gapd Peptidyl-cysteine S-nitrosylase GAPDH protein protein mouse Mus musculus Mouse MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE DIP protein P16858 original sequence version: 160 F25131EFFA9F2BD6 s10a9_human Protein S100-A9 S100 calcium-binding protein A9 Calgranulin-B Migration inhibitory factor-related protein 14 Leukocyte L1 complex heavy chain Calprotectin L1H subunit S100A9 CAGB CFAG MRP14 protein protein human Homo sapiens Human MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP C3BE19729E14C078 gapdh-nos2 7 12 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 1E, Supp 1 nos2-gapdh 7 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 1E, Supp Fig. 1 gapdh-nos2-1 6 12 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Oxidised LDL (CHEBI:60151) Fig. 1F nos2-gapdh-1 6 14 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 12 unspecified role unspecified role prey prey physical association physical association Oxidised LDL (CHEBI:60151) Fig. 1F gapdh-rpl13a-1 1 16 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 1H Interferon-gamma GAPDH-L13a interaction was not inhibited by oxidised LDL/IFN-gamma in iNOS−/− cells oxidised LDL (CHEBI:60151) and Interferon-gamma gapdh-hist1h4a 2 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2A, Supplemental Table 1 Histone H2A was also present in the complex but could not be mapped to a single gene product. nos2-gapdh-2 2 17 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2A, Supp. Table 1 Histone H2A was also present in the complex but could not be mapped to a single gene product. nos2-gapdh-3 7 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2C, 2D s100a8-gapdh 7 13 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2C s100a9-gapdh 7 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2C gapdh-nos2-2 7 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2C nos2-gapdh-4 7 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2D Interaction observed in S100A8 -/- cells nos2-gapdh-5 7 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2D Interaction observed in GAPDH -/- cells nos2-gapdh-6 4 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 2E, 2F Oxidised LDL (CHEBI:60151) BAPTA-AM cell-permeable calcium chelator (CHEBI:60888) EGTA calcium chelator (CHEBI:30740) s100a9-nos2 4 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 3E s100a9-s100a8 4 17 unspecified role unspecified role bait bait P06702:p.Cys3Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:10:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys3ala' Tue Jun 30 19:41:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3Ala' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 13 unspecified role unspecified role prey prey physical association physical association Oxidised LDL (CHEBI:60151) and interferon-gamma Fig. 3E The S100A9 Cys3Ala mutant interacted with S100A8 but failed to bind iNOS, suggesting Cys3S-nitrosylation is required for complex assembly s100a8-gapdh-1 5 12 unspecified role unspecified role prey prey purified purified 13 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Expression system of proteins not clear but both are stated to be purified. Fig. 4C s100a8-gapdh-2 3 12 unspecified role unspecified role prey prey purified purified n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true P05109:p.Cys42Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 20:14:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys42ser' Tue Jun 30 16:18:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys42Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction Wild-type S100A8 and three mutants (Ile22Cys/Cys42Ser, Asp32Cys/Cys42Ser, and Asp52Cys/Cys42Ser) caused marked cleavage of GAPDH in helices alpha-1 and alpha-3 Fig. 4D I have not added these mutants as features as the method is so engineered I don't think they have any biological meaning. s100a8-gapdh-3 8 13 unspecified role unspecified role ancillary ancillary purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role fret pair fluorescence acceptor donor pair fret pair purified purified P04406:p.Cys156Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:52:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys156ser' Tue Jun 30 17:31:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys156Ser' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cys-152/247 alexa 546 label alexa 546 label certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain cys-152/247 alexa label alexa label certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction S100A8 Binding Induces a Conformational Change in GAPDH Supp. Fig 2