IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A memory system of negative polarity cues prevents replicative aging. A memory system of negative polarity cues prevents replicative aging. Cell (0092-8674) 2014 imex curation Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Accepted 2015-MAR-02 by MGT Cell (0092-8674) 2014 imex curation A memory system of negative polarity cues prevents replicative aging. A memory system of negative polarity cues prevents replicative aging. Cell (0092-8674) 2014 imex curation Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Accepted 2015-MAR-02 by MGT Cell (0092-8674) 2014 imex curation A memory system of negative polarity cues prevents replicative aging. A memory system of negative polarity cues prevents replicative aging. Cell (0092-8674) 2014 imex curation Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Accepted 2015-MAR-23 by MGT Cell (0092-8674) 2014 imex curation A memory system of negative polarity cues prevents replicative aging. A memory system of negative polarity cues prevents replicative aging. Cell (0092-8674) 2014 imex curation Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meitinger F., Khmelinskii A., Morlot S., Kurtulmus B., Palani S., Andres-Pons A., Hub B., Knop M., Charvin G., Pereira G. g.pereira@dkfz.de Accepted 2015-FEB-27 by MGT Cell (0092-8674) 2014 imex curation cla4_yeast Serine/threonine-protein kinase CLA4 CLA4 N0450 YNL298W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLSAAANKISDNDFQNIGPAPRPPSSNSQGRTCYNQTQPITKLMSQLDLTSASHLGTSTSKKKSGWVSYKDDGILSFIWQKRYLMLHDSYVALYKNDKQNDDAILKIPLTSIISVSRTQLKQYCFELVRCSDRNSVSSGSSSSLNVSSDSNSKKSIYIATKTESDLHSWLDAIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWNNNSAAVIQVLQFYQEYNGAGNPTNTLDKPQSGETSSSQKSLPNSYNDNKLRNNSVNSKSSSGVSSSMVSQRKTSQPPNTKSPVSLGSGSLPPINTKLPTSQSNIPRHLQNVPNQQYPKMRNGHSPTNGQFPRGPMHPNNSQRSLQQQQQQQQQQKQQHQQYPYHHQGPSPSPSPSPSPLNPYRPHHNMINPYSKQPQSPLSSQSTQNQAIPRYAQNSSPTAAHFQPQRTAPKPPISAPRAPYPSNQNATSNTHVQPVAPKNDQSTPQTMRQAPKRPDADVAQPGGVAKPKKPARPTMSTAEIMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFNMACDPKDLTSLLEWKE 3A2AB86414561DC6 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF nba1_yeast Protein NBA1 YOL070C NBA1 NAP1 and bud neck-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEREENGISRATLNTQRLSAMIDSLNNEKDDRLFPSPTTTRTMITEEKADQSDVFKPPSRLLRSPAGDVSLPPGDNRSSMISNYSGIIQEGVEVSYVVKNRQQTQERRTSKDSNSLYSLKEPVSKNELPSLPMLPSEATLTKHLSDNQSTKSNTNADEIVIKPVTNAKPVGRFNSNTSKKVEGRGSLKLLSSPLRQEKVMRSSIGSGNLASESGSSTYNTKFHQSIQEQLEEEEEGNVSDKLSIVSSVIPELYTTTNEAPKAINPIRSETNDYNPTIPPRSKDRPRSRLFIEEGDGEGDLLTEEILPTPVQPGGHYKNSSQISTVSEQKSESYYSAATSMPPEEETYLTRPLPSTPNEDSRVTSNLKRDDTLKAIHDRANHTSTSTNKQDDDMYEDIIEETPKKTKLKKDTKKKLNKKKSVKELRSFDIDTLNQLLSVTKGTLIGSEFAQLGMKIEEKRALERLVDSLSRLTADMVLDPDRYEEGLKRLDKATKALEGF 8128246D00B9C03D 8128246D00B9C03D cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C 30BD644BA9836B2C aim44_yeast Altered inheritance of mitochondria protein 44 P2570 YPL158C AIM44 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIIRAPIRTKTKSFRGDQMDFKFPSNESLPRGTLEEYHLNNHHLLNDVFAAENGVSRDEDGNSQTLSDYTSTSNTNTNSGYSSNGYYSFANISDNTTSSPRIVINQNETARLTSSDSNKSDFFASHDFPGNDSLHYSSSNVVKNQLHSMEAIPEGNITGSISTAFQTIPTADNVSYDIAPSSASSLLPRKSTSKSAILPSTQEAKPMTKLNMEKDIKTIELNNSVVPKPKKKLNRVPTIRRVESSRFSNSRYSSSVSSKSSSSRCSLKRSKAIRCKGGLLYYFTSLGIKIKKKLRKLRLVLRRRLFSYNVQKVPSATNSKTTKSKANINNKSKKRGTNLVNKNSNSTPRQKKSQRYVSNLQRSISSKSLVPVLAPQKKTKPLTVDTKFKANHPQSEDSKVGSNTPRSPLVSYTPSLRRTNSSIRRAASILTASATMTPANNKNSFISVPDNVSHAVTRNSSMYSRSRLVRSKPSTALNAIARQPSIVVENKVIPLSMNRYSIKEEDEYVIDTSSMRELSPVNSVCSSDYDRESSESYSNYADAMETTEVDNKDRVECNNEIQNVDANNEETSNEESYNLMKHYLSTVIAQRIMLRVQIARIQNYKSNVVYMNKSAETNSTIYEDLVDSLLTEYEADGSSSQIFDGVTVRADEEEEEDEDDEDDEEEEEENDDEEDEEDEEDDEDDEEEEEKRKEGEGRNLAKEVDELAELSPMRKQSDLSITLRSPFAMLNPAYSNSIISLPTGVVKRSLTLPVGMKI 3B4FA92B91C87F2B 3B4FA92B91C87F2B nap1_yeast Nucleosome assembly protein NAP1 YKR048C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDPIRTKPKSSMQIDNAPTPHNTPASVLNPSYLKNGNPVRAQAQEQDDKIGTINEEDILANQPLLLQSIQDRLGSLVGQDSGYVGGLPKNVKEKLLSLKTLQSELFEVEKEFQVEMFELENKFLQKYKPIWEQRSRIISGQEQPKPEQIAKGQEIVESLNETELLVDEEEKAQNDSEEEQVKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYDHAEGCEISWKDNAHNVTVDLEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLEERLALDYSIGEQLKDKLIPRAVDWFTGAALEFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEEQDDFAGRPEQAPECKQS C0F97FBA1B9EEA83 C0F97FBA1B9EEA83 cdc24_yeast Cell division control protein 24 CLS4 YAL041W CDC24 Calcium regulatory protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MAIQTRFASGTSLSDLKPKPSATSISIPMQNVMNKPVTEQDSLFHICANIRKRLEVLPQLKPFLQLAYQSSEVLSERQSLLLSQKQHQELLKSNGANRDSSDLAPTLRSSSISTATSLMSMEGISYTNSNPSATPNMEDTLLTFSMGILPITMDCDPVTQLSQLFQQGAPLCILFNSVKPQFKLPVIASDDLKVCKKSIYDFILGCKKHFAFNDEELFTISDVFANSTSQLVKVLEVVETLMNSSPTIFPSKSKTQQIMNAENQHRHQPQQSSKKHNEYVKIIKEFVATERKYVHDLEILDKYRQQLLDSNLITSEELYMLFPNLGDAIDFQRRFLISLEINALVEPSKQRIGALFMHSKHFFKLYEPWSIGQNAAIEFLSSTLHKMRVDESQRFIINNKLELQSFLYKPVQRLCRYPLLVKELLAESSDDNNTKELEAALDISKNIARSINENQRRTENHQVVKKLYGRVVNWKGYRISKFGELLYFDKVFISTTNSSSEPEREFEVYLFEKIIILFSEVVTKKSASSLILKKKSSTSASISASNITDNNGSPHHSYHKRHSNSSSSNNIHLSSSSAAAIIHSSTNSSDNNSNNSSSSSLFKLSANEPKLDLRGRIMIMNLNQIIPQNNRSLNITWESIKEQGNFLLKFKNEETRDNWSSCLQQLIHDLKNEQFKARHHSSTSTTSSTAKSSSMMSPTTTMNTPNHHNSRQTHDSMASFSSSHMKRVSDVLPKRRTTSSSFESEIKSISENFKNSIPESSILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY 856BCAF4EB0A67D1 856BCAF4EB0A67D1 rax2_yeast Bud site selection protein RAX2 RAX2 YLR084C Revert to axial protein 2 L2389 L9449.12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV C8D83EA5C903ADE8 rsr1_yeast Ras-related protein RSR1 RSR1 BUD1 YGR152C G6658 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLINERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVKDARNQSQQFSKIESPSTRLPSSAKQDTKQSNNKQSSKGLYNKSSQGQAKVKQSTPVNEKHKPSHAVPKSGSSNRTGISATSQQKKKKKNASTCTIL 6FF0B6C9E114A6DC 6FF0B6C9E114A6DC bem1_yeast Bud emergence protein 1 Suppressor of RHO3 protein 1 BEM1 SRO1 YBR200W YBR1412 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKNFKLSKRDSNGSKGRITSADISTPSHDNGSVIKHIKTVPVRYLSSSSTPVKSQRDSSPKNRHNSKDITSPEKVIKAKYSYQAQTSKELSFMEGEFFYVSGDEKDWYKASNPSTGKEGVVPKTYFEVFDRTKPSSVNGSNSSSRKVTNDSLNMGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVEQQQQQSITKPQNKSAKLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVLNNGFDREFERDENQNNIKTLQENDTATFATASQTSNFASTNQDNTLTGEDLKLNKKLSDLSLSGSKQAPAQSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI FB6C525AE9A19181 FB6C525AE9A19181 nis1_yeast Protein NIS1 YNL078W N2337 NIS1 JIP1 Neck protein interacting with septins protein 1 Jumonji domain-interacting protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast METYETSIGTQSYPPTLFPPPLGTGGFTTSGYIHALVDSTSNSNSNSNTNSNTNSNTNSNSDTKIPIVQISDDSHITHDSFKPYMEYHDASHLRNRNISKADQVESTEVMEQFTQWSNYKMRSRSPTINAKPIRHTSQRRTDFTSKNELSKFSKNHNFIFHKGFLKRQHSIRREDRQAKVRSRFRSKKELTSVLNYIELEQMDIANVLASQPVNLHAIRNLTSRDPAVTPIPFLRSQMYATSSRPPYLRNRSISRKLPKSQPGSLPTTMPATATKTIKQNSTTPTTRSVYNKNVGRSNTSPSVLYHPKRRGKLNTKSHARKEQLLLELWREYLMLVITQRTQLRLTLLCSPGSASNESSVCSSNASDLDMSLLSTPSSLFQMAGETKSNPIIIPDSQDDSILSSDPF 925C7B6063BCE4F1 925C7B6063BCE4F1 aim44-nap1 4 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C aim44-nba1 4 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C aim44-nis1 4 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 10 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C aim44-nis1-1 4 7 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 9 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true physical association physical association Fig. 1C aim44-cdc42 1 9 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 2A, 3A, Supp Fig. 2A aim44-nis1-2 1 9 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true 15 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 2A, Supp Fig. 2A aim44-nap1-3 1 10 unspecified role unspecified role unspecified role unspecified role 9 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true physical association physical association Fig. 2A,3A,2C, Supp Fig. 2A aim44-nba1-1 1 7 unspecified role unspecified role unspecified role unspecified role 9 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true physical association physical association Fig. 2A, 2C, Supp Fig. 2A nba1-aim44-1 3 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2B aim44-nis1-4 3 10 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2B nis1-aim44-1 3 15 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2B cdc24-bem1-2 3 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast association association Supp. Fig. 3B, 3D Nba1 was not able to disassemble or to prevent the assembly of Cdc24-Bem1-Cla4 complexes cdc24-bem1-3 3 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true yeast Saccharomyces cerevisiae Baker's yeast 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true yeast Saccharomyces cerevisiae Baker's yeast association association Supp. Fig. 3B/D Nba1 was not able to disassemble or to prevent the assembly of Cdc24-Bem1-Cla4 complexes cdc24-bem1-4 3 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true yeast Saccharomyces cerevisiae Baker's yeast 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true yeast Saccharomyces cerevisiae Baker's yeast association association Supp. Fig. 3B/D Nba1 was not able to disassemble or to prevent the assembly of Cdc24-Bem1-Cla4 complexes cdc24-bem1-5 3 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeast Saccharomyces cerevisiae Baker's yeast 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 3B, 3D, 3E Nba1 was not able to disassemble or to prevent the assembly of Cdc24-Bem1-Cla4 complexes nba1-bem1-5 3 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true yeast Saccharomyces cerevisiae Baker's yeast 7 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 3C nba1-cdc24-2 3 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true yeast Saccharomyces cerevisiae Baker's yeast 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 3B bem1-nba1 1 7 unspecified role unspecified role unspecified role unspecified role 14 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3A cdc24-nba1 1 7 unspecified role unspecified role unspecified role unspecified role 11 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 3A nba1-cdc24-1 3 11 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3G nba1-bem1-1 3 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3B cdc24-nba1-1 2 11 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 7 unspecified role unspecified role neutral component neutral component region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true colocalization colocalization 3C bem1-nba1-1 2 7 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 unspecified role unspecified role neutral component neutral component region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true colocalization colocalization Fig. 3C nba1-bem1-2 3 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3G nba1-bem1-3 3 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) physical association physical association Fig. 3G Bem1 and Cdc42 compete for binding to Nba1. nba1-bem1-4 3 7 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 3C nap1-nis1-1 1 15 unspecified role unspecified role unspecified role unspecified role 12 unspecified role unspecified role unspecified role unspecified role c-terminal domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role ancillary ancillary physical association physical association SUpp. Fig. 4D, 4E cdc24-rsr1-1 3 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true yeast Saccharomyces cerevisiae Baker's yeast 13 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3H Nba1 was not able to disassemble or to prevent the assembly of Cdc24-Bem1-Cla4 complexes