IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner. Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner. J. Biol. Chem. (0021-9258) 2014 imex curation Louw-du Toit R., Hapgood J.P., Africander D. IBD - Inflammatory bowel disease drho@sun.ac.za 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-ect1/e6e7 Homo sapiens ectocervical epithelial HPV-16 E6/E7 transformed cell line ect1/e6e7 ectocervical epithelial HPV-16 E6/E7 transformed cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Louw-du Toit R., Hapgood J.P., Africander D. IBD - Inflammatory bowel disease RE-ChIP: sequential ChIP where immunoprecipitates from a first round of IP were re-precipitated with a second antibody, allowing for the identification of multiple (concurrently binding) proteins on a single DNA sequence. Cells were incubated with 0.02 micrograms/ml TNF in the absence or presence of 0.1% ethanol or 1 micromolar P4, MPA, or cortisol for 2 hours prior to the ChIP assay. drho@sun.ac.za Accepted 2015-JAN-22 by MGT J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner. Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner. J. Biol. Chem. (0021-9258) 2014 imex curation Louw-du Toit R., Hapgood J.P., Africander D. IBD - Inflammatory bowel disease drho@sun.ac.za 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-ect1/e6e7 Homo sapiens ectocervical epithelial HPV-16 E6/E7 transformed cell line ect1/e6e7 ectocervical epithelial HPV-16 E6/E7 transformed cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Louw-du Toit R., Hapgood J.P., Africander D. IBD - Inflammatory bowel disease Cells were incubated with 0.02 micrograms/ml TNF in the absence or presence of 0.1% ethanol or 1 micromolar P4, MPA, or cortisol for 2 hours prior to the ChIP assay. drho@sun.ac.za Accepted 2015-JAN-22 by MGT J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC DIP protein P17676 original sequence version: 102 9B725BD6CCAA771D il10_human_gene Interleukin-10 (IL10) human gene gene gene human Homo sapiens Human il12b_human_gene Interleukin-12 subunit beta (IL12B) human gene IL12B NKSF2 gene gene human Homo sapiens Human tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 gcr_human Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 NR3C1 GRL protein protein human Homo sapiens Human MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK C5C90C9A5DD16AAB nr3c1-il12b 2 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter region nfkb/cebpb site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4b cortisol (CHEBI:17650) progesterone (P4) (CHEBI:17026) medroxyprogesterone acetate (MPA) (CHEBI:6716) CHEBI:17650 increases binding of P04150 to ENSG00000113302 CHEBI:6716 increases binding of P04150 to ENSG00000113302 CHEBI:17026 increases binding of P04150 to ENSG00000113302 CHEBI:17650 indirectly increases expression at RNA level of ENSG00000113302 CHEBI:6716 indirectly increases expression at RNA level of ENSG00000113302 CHEBI:17026 indirectly increases expression at RNA level of ENSG00000113302 P04150 increases expression at RNA level of ENSG00000113302 P04150 increases expression at protein level of ENSG00000113302 CHEBI:17650 indirectly increases expression at protein level of ENSG00000113302 CHEBI:6716 indirectly increases expression at protein level of ENSG00000113302 CHEBI:17026 indirectly increases expression at protein level of ENSG00000113302 nr3c1-il12b-1 2 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter region sp1 site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4c cortisol (CHEBI:17650) nr3c1-il10 2 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region sp1/stat3 site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5b cortisol (CHEBI:17650) progesterone (P4) (CHEBI:17026) medroxyprogesterone acetate (MPA) (CHEBI:6716) CHEBI:17650 increases binding of P04150 to ENSG00000136634 CHEBI:6716 increases binding of P04150 to ENSG00000136634 CHEBI:17026 increases binding of P04150 to ENSG00000136634 CHEBI:17650 indirectly decreases expression at RNA level of ENSG00000136634 CHEBI:6716 indirectly decreases expression at RNA level of ENSG00000136634 CHEBI:17026 indirectly decreases expression at RNA level of ENSG00000136634 P04150 decreases expression at RNA level of ENSG00000136634 P04150 decreases expression at protein level of ENSG00000136634 CHEBI:17650 indirectly decreases expression at protein level of ENSG00000136634 CHEBI:6716 indirectly decreases expression at protein level of ENSG00000136634 CHEBI:17026 indirectly decreases expression at protein level of ENSG00000136634 rela-il12b-1 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 7 unspecified role unspecified role bait bait association association Fig. 6b This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-GR antibody. cortisol (CHEBI:17650) progesterone (P4) (CHEBI:17026) medroxyprogesterone acetate (MPA) (CHEBI:6716) CHEBI:6716 increases binding of Q04206 to ENSG00000113302 CHEBI:17026 increases binding of Q04206 to ENSG00000113302 CHEBI:17650 increases binding of Q04206 to ENSG00000113302 Q04206 increases expression at RNA level of ENSG00000113302 stat3-il10-1 1 8 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true association association Fig. 7a This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-GR antibody. cortisol (CHEBI:17650) progesterone (P4) (CHEBI:17026) medroxyprogesterone acetate (MPA) (CHEBI:6716) CHEBI:6716 increases binding of P40763 to ENSG00000136634 CHEBI:17026 increases binding of P40763 to ENSG00000136634 CHEBI:17650 increases binding of P40763 to ENSG00000136634 P40763 decreases expression at RNA level of ENSG00000136634 cebpb-il12b-1 1 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true association association Fig. 6a cortisol (CHEBI:17650) progesterone (P4) (CHEBI:17026) medroxyprogesterone acetate (MPA) (CHEBI:6716) This interaction was observed in a re-ChIP experiment, after an initial ChIP using anti-GR antibody. CHEBI:6716 increases binding of P17676 to ENSG00000113302 CHEBI:17026 increases binding of P17676 to ENSG00000113302 CHEBI:17650 increases binding of P17676 to ENSG00000113302 P17676 increases expression at RNA level of ENSG00000113302