IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-17 by ORCHARD Nucleic acids research 2013 imex curation Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-17 by ORCHARD Nucleic acids research 2013 imex curation Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom rt-pcr reverse transcription pcr RT-PCR Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-21 by ORCHARD Nucleic acids research 2013 imex curation Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-17 by ORCHARD Nucleic acids research 2013 imex curation Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-21 by ORCHARD Nucleic acids research 2013 imex curation I have deleted roth-3 and left a single experiment with the exp annotation. They cleave the his tag but there is a GPHM or GPH tag still remaining in both proteins; I have corrected the entry for Nop58; sorry, my mistake Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-21 by ORCHARD Nucleic acids research 2013 imex curation Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) chromatography chromatography technology column chromatography chromatography sequence tag sequence tag identification sequence tag Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. Following IMAC chromatography, complexes were released by cleavage of the His6 tag and furhter purified by size exclusion chromatography. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-21 by ORCHARD Nucleic acids research 2013 imex curation Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. Nucleic acids research 2013 imex curation Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Rothé B., Saliou JM., Quinternet M., Back R., Tiotiu D., Jacquemin C., Loegler C., Schlotter F., Peña V., Eckert K., Moréra S., Dorsselaer AV., Branlant C., Massenet S., Sanglier-Cianférani S., Manival X., Charpentier B. bruno.charpentier@univ-lorraine-nancy.fr Accepted 2015-AUG-21 by ORCHARD Nucleic acids research 2013 imex curation fbrl_yeast rRNA 2'-O-methyltransferase fibrillarin NOP1 LOT3 YDL014W D2870 U3 small nucleolar RNA-associated protein NOP1 Histone-glutamine methyltransferase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMRSGLKK 56A8B958A7B6066E 56A8B958A7B6066E ruvb1_yeast RuvB-like protein 1 RVB1 TIP49-homology protein 1 TIP49a homolog TIH1 TIP49A YDR190C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAISEVKENPGVNSSNSGAVTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILETSANYL 93D6ECB7006AF0F2 93D6ECB7006AF0F2 ruvb2_yeast RuvB-like protein 2 TIP49-homology protein 2 TIP49b homolog RVB2 TIH2 TIP49B YPL235W P1060 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIAKSADPDAMDTTE 0D8EFBA7EC711AB8 0D8EFBA7EC711AB8 tah1_yeast TPR repeat-containing protein associated with Hsp90 YCR60W YCR060W TAH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS 3738DE6F227F803A 3738DE6F227F803A nufp1_human Nuclear fragile X mental retardation-interacting protein 1 Nuclear FMRP-interacting protein 1 NUFIP1 protein protein human Homo sapiens Human MAEPTSDFETPIGWHASPELTPTLGPLSDTAPPRDSWMFWAMLPPPPPPLTSSLPAAGSKPSSESQPPMEAQSLPGAPPPFDAQILPGAQPPFDAQSPLDSQPQPSGQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV DIP protein Q9UHK0 original sequence version: 84 318418FB08071001 znhi3_human Zinc finger HIT domain-containing protein 3 TRIP3 Thyroid receptor-interacting protein 3 Thyroid hormone receptor interactor 3 HNF-4a coactivator ZNHIT3 protein protein human Homo sapiens Human MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES A115FD0AA9321AB0 pih1_yeast Protein interacting with Hsp90 1 PIH1 NOP17 Nucleolar protein 17 YHR034C protein protein yeast Saccharomyces cerevisiae Baker's yeast MADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFINVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDYKAKMHKIIEEEAGDPMSILRGRNDDGDDNNDPDDGTLPPLFPIENKISGAKIEEIDKNEIAHRNLKQAPAPAPAPHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYIYI 02C06D0A113B1B3B 02C06D0A113B1B3B snru14 yeast small nucleolar RNA U14 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast UCACGGUGAUGAAAGACUGGUUCCUUAACAUUCGCAGUUUCCACGGUAGGAGUACGCUUACGAACCCAUCGUUAGUACUCUCGGUGACCGCUCUUCUUUAGAGACCUUCCUAGGAUGUCUGAGUGA snu13_yeast 13 kDa ribonucleoprotein-associated protein YEL026W SNU13 Small nuclear ribonucleoprotein-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI 4489780153E8F182 4489780153E8F182 rsa1_yeast Ribosome assembly 1 protein RSA1 YPL193W protein protein yeast Saccharomyces cerevisiae Baker's yeast MNYNNFENSKGDGHSRLPKPTYSGTLSDGYDESKIKRQKTDSAFNAAYSPHMYPNSPYYEGSWNTGYTPQLHHVAPHNQYFHPIQPSTQYNYTSPPNYTENYIPPVHQNISYAPALNLQKWPSSYCENTQALKNDKDYQTSISYEDVAIPTVKEIQLIEKNRGKDTFMNEISPVPSSKDQASAEPTEIPRKDPELANSNAEDDHNNLGLEDDDRDEQLESEGLGKVVLVPGTSIALITDEDVKKWREERKKMWLLKISNNKQKHMQEMGIKEDELKSQPSIFKESRKEKQFIQSIQNQVQRGNPKIDLNLKLIQREFANENSQLLDFIRELGDVGLLEYELSQQEKDVLFGSSEDNNKNHYKPNYKNRKPNLSRANFTRNK 16058BA430E0F310 nop58_yeast Nucleolar protein 58 Nucleolar protein 5 NOP58 NOP5 YOR310C O6108 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAYVLTETSAGYALLKASDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEEANSIIEGKVSSQLEKLLEEIKKDKKSTLIVSETKLANAINKLGLNFNVVSDAVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEEIEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAKKVEMTEARAYNADADTAKAASDSESDSDDEEEEKKEKKEKKRKRDDDEDSKDSKKAKKEKKDKKEKKEKKEKKEKKEKKEKKEKKSKKEKKEKK 8A2889448B2A19E2 8A2889448B2A19E2 hit1_yeast Protein HIT1 J1705 YJR055W HIT1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSSAVKCGICRGVDGKYKCPKCGVRYCSLKCYKDAAKHVHKESEQPRAGTEANVEVVNNDKIINSSLAMNKTLKTKAFDDIYQNSAELQELLKYNTVKFHLAKVYRILSSTVNDGSSGKMNSDLQKELAVNYLNTLRYGGIHYNEAIEEFCQILLDKLNAVKK EAC6ABB5457F87AA nop56_yeast Nucleolar protein 56 SIK1 Ribosome biosynthesis protein SIK1 YLR197W L8167.9 NOP56 Suppressor of I kappa b protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKPTLKNELAIQEAMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKKDKKEKKDKKKKSKD F8522A5870EF4842 F8522A5870EF4842 snru3a yeast small nuclear RNA U3a Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GUCGACGUACUUCAGUAUGUAAUAUACCCCAAACAUUUUACCCACAAAAAACCAGGAUUUGAAAACUAUAGCAUCUAAAAGUCUUAGGUACUAGAGUUUUCAUUUCGGAGCAGGCUUUUUGAAAAAUUUAAUUCAACCAUUGCAGCAGCUUUUGACUAACACAUUCUACAGUAGGAUCAUUUCUAUAGGAAUCGUCACUCUUUGACUCUUCAAAAGAGCCACUGAAUCCAACUUGGUUGAUGAGUCCCAUAACCUUUGUACCCCAGAGUGAGAAACCGAAAUUGAAUCUAAAUUAGCUUGGUCCGCAAUCCUUAGCGGUUCGGCCAUCUAUAAUUUUGAAUAAAAAUUUUGCUUUGCCGUUGCAUUUGUAGUUUUUUCCUUUGGAAGUAAUUACAAUAUUUUAUGGCGCGAUGAUCUUGACCCAUCCUAUGUACUUCUUUUUUGAAGGGAUAGGGCUCUAUGGGUGGGUACAAAUGGCAGUCUGACAAGU pih1-1 6 19 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Table 1 rsa1-1 6 21 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Table 1 hit1-1 6 9 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association table1 rsa1_hit1-1 4 20 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig1A rsa1_hit1-2 7 18 unspecified role unspecified role neutral component neutral component tag GPHM tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role neutral component neutral component physical association physical association Fig1B,D snu13p_rsa1-2 7 17 unspecified role unspecified role neutral component neutral component tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tag GPHM tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 20 unspecified role unspecified role neutral component neutral component physical association physical association Fig1C, E u3_snu13p-1 2 22 unspecified role unspecified role bait bait label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain deletion sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined stem-loops 2,3,4 of U3 are deleted in the used construct in vitro In vitro 17 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig1G snu13-snru14 yeast-1 2 16 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role bait bait tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig1G hit1-snru14 yeast-1 2 20 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role bait bait label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro 17 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig1G hit1-snru3a yeast-2 2 20 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 22 unspecified role unspecified role bait bait N/A 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined stem-loops 2,3,4 of U3 are deleted in the used construct in vitro In vitro association association Fig1G snru3a_rsa1-1 2 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 22 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined stem-loops 2,3,4 of U3 are deleted in the used construct label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro association association Fig1G snru14_rsa1-1 2 17 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role bait bait label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain in vitro In vitro association association Fig1G snu13-hit1-1 8 19 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 18 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role bait bait tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) association association Fig1H rsa1-nop58-1 8 19 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 18 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role bait bait tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig1H hit1-nop58-1 8 19 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 18 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) association association Fig1H pih1-4 8 19 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 12 unspecified role unspecified role bait bait tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) association association Fig1H nop58_u3-1 3 19 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 22 unspecified role unspecified role prey prey physical association physical association Fig4B nop1_u3-1 3 22 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4B nop56_u3-1 3 22 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4B rsa1_u3-1 3 22 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4C hit1_u3-1 3 22 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4C pih1_u3-1 3 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4C rvb1_u3-1 3 22 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4C rvb2_u3-1 3 22 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4C nufip1-znhit3-1 1 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig5D znhit3-nufip1-1 1 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Fig5D rsa1_hit1-3 5 20 unspecified role unspecified role neutral component neutral component label 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role neutral component neutral component label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 175 178 direct interaction direct interaction Fig6, Fig7