MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Allosteric regulation of rhomboid intramembrane proteolysis. Allosteric regulation of rhomboid intramembrane proteolysis. EMBO J. (0261-4189) 2014 imex curation Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca Accepted 2015-FEB-19 by MARTA EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Allosteric regulation of rhomboid intramembrane proteolysis. Allosteric regulation of rhomboid intramembrane proteolysis. EMBO J. (0261-4189) 2014 imex curation Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca Accepted 2015-FEB-19 by MARTA EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Allosteric regulation of rhomboid intramembrane proteolysis. Allosteric regulation of rhomboid intramembrane proteolysis. EMBO J. (0261-4189) 2014 imex curation Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca Accepted 2015-FEB-19 by MARTA EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Allosteric regulation of rhomboid intramembrane proteolysis. Allosteric regulation of rhomboid intramembrane proteolysis. EMBO J. (0261-4189) 2014 imex curation Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Arutyunova E., Panwar P., Skiba P.M., Gale N., Mak M.W., Lemieux M.J. joanne.lemieux@ualberta.ca Accepted 2015-FEB-19 by MARTA EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation a1yh68_prost Sec-independent protein translocase protein TatA tatA NCTC12257_03922 protein protein prost Providencia stuartii MESTIATAAFGSPWQLIIIALLIILIFGTKKLRSLGSDLGESLKGFKKAMNDDEAAKAAKEEQEKQDADFAPKNITEQQQAADKKDSPVESKNKEQG DIP protein A1YH68 original sequence version: 38 5C0EC2E3E65B9304 glpg_ecoli Rhomboid protease GlpG Intramembrane serine protease JW5687 b3424 glpG protein protein ecoli Escherichia coli (strain K12) MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPADPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK DIP protein P09391 original sequence version: 116 DIP protein P09391 original sequence version: 121 6F67374E609968FC glpg_haein Rhomboid protease GlpG glpG Intramembrane serine protease HI_0618 protein protein haein Haemophilus influenzae MKNFLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFFIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLE B76A7A658037217E aara_prost Rhomboid protease AarA aarA Intramembrane serine protease protein protein prost Providencia stuartii MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIYQLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAALFSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQRRQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITVIAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ DIP protein P46116 original sequence version: 64 13EC8B5C66284B1E aara-tata 2 8 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot enzyme enzyme neutral component neutral component purified purified 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage f1b f1c t1 sf1 f4f sf4a For all three rhomboids, we observed a loss of activity in the presence of DM, at conditions where the protein exists as a monomer. For AarA, purified in DDM, only 50% of activity was observed in DM reaction buffer, consistent with the gel filtration results, showing only partial dissociation. A full loss of activity for AarA was observed only when DM was used in both Ni-NTA purification and the activity assay. aara-tata-1 2 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot enzyme enzyme neutral component neutral component purified purified 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage f1b f1c t1 sf1 f4e sf4b For all three rhomboids, we observed a loss of activity in the presence of DM, at conditions where the protein exists as a monomer. For AarA, purified in DDM, only 50% of activity was observed in DM reaction buffer, consistent with the gel filtration results, showing only partial dissociation. A full loss of activity for AarA was observed only when DM was used in both Ni-NTA purification and the activity assay. glpg-tata 2 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified 7 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot enzyme enzyme neutral component neutral component purified purified cleavage cleavage reaction cleavage f1b f1c t1 f4d sf4c For all three rhomboids, we observed a loss of activity in the presence of DM, at conditions where the protein exists as a monomer. For AarA, purified in DDM, only 50% of activity was observed in DM reaction buffer, consistent with the gel filtration results, showing only partial dissociation. A full loss of activity for AarA was observed only when DM was used in both Ni-NTA purification and the activity assay. aara-tata-2 3 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified P46116:p.Phe105Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:53:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe105ala' Tue Jun 30 16:31:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe105Ala' 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified ypet yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cypet cyanine label cyanine label n-term range n-terminal range n-term range n-term range n-terminal range n-term range cleavage cleavage reaction cleavage f2b f2c t2 aara-tata-3 1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4c aara-4 1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4b glpg-1 1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4a sf5a glpg-1 4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf5c