HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Functional characterization of the type III secretion ATPase SsaN encoded by Salmonella pathogenicity island 2. Functional characterization of the type III secretion ATPase SsaN encoded by Salmonella pathogenicity island 2. PloS one 2013 imex curation Yoshida Y., Miki T., Ono S., Haneda T., Ito M., Okada N. okadan@pharm.kitasato-u.ac.jp Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yoshida Y., Miki T., Ono S., Haneda T., Ito M., Okada N. okadan@pharm.kitasato-u.ac.jp Accepted 2015-APR-01 by ORCHARD PloS one 2013 imex curation Functional characterization of the type III secretion ATPase SsaN encoded by Salmonella pathogenicity island 2. Functional characterization of the type III secretion ATPase SsaN encoded by Salmonella pathogenicity island 2. PloS one 2013 imex curation Yoshida Y., Miki T., Ono S., Haneda T., Ito M., Okada N. okadan@pharm.kitasato-u.ac.jp Only protein-protein interactions imex curation in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Yoshida Y., Miki T., Ono S., Haneda T., Ito M., Okada N. okadan@pharm.kitasato-u.ac.jp Accepted 2015-APR-01 by ORCHARD PloS one 2013 imex curation h9l491_salty sscB STM1403 protein protein salty Salmonella typhimurium MMMKEDQKNKIPEDILKQLLSVDPETVYASGYASWQEGDYSRAVIDFSWLVMAQPWSWRAHIALAGTWMMLKEYTTAINFYGHALMLDASHPEPVYQTGVCLKMMGEPGLAREAFQTAIKMSYADASWSEIRQNAQIMVDTLIA B60EDA7F0E325B0B sctl2_salty SPI-2 type 3 secretion system stator protein sctL2 Secretion system apparatus protein SsaK ssaK STM1411 protein protein salty Salmonella typhimurium MSFTSLPLTEINHKLPARNIIESQWITLQLTLFAQEQQAKRVSHAIVSSAYRKAEKIIRDAYRYQREQKVEQQQELACLRKNTLEKMEVEWLEQHVKHLQDDENQFRSLVDHAAHHIKNSIEQVLLAWFDQQSVDSVMCHRLARQATAMAEEGALYLRIHPEKEALMRETFGKRFTLIIEPGFSPDQAELSSTRYAVEFSLSRHFNALLKWLRNGEDKRGSDEY 533A24B4840302BC h9l426_salty sscA STM1399 protein protein salty Salmonella typhimurium MKKDPTLQQAHDTMRFFRRGGSLRMLLDDDVTQPLNTLYRYATQLMEVKEFAGAARLFQLLTIYDAWSFDYWFRLGECCQAQKHWGEAIYAYGRAAQIKIDAPQAPWAAAECYLACDNVCYAIKALKAVVRICGEVSEHQILRQRAEKMLQQLSDRS 2309489848FC3101 sctn2_salty SPI-2 type 3 secretion system ATPase sctN2 ssaN STM1415 protein protein salty Salmonella typhimurium MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQQVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPDVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGIFSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFFRDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADEVRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRCLALYQEVELLIRIGEYQRGVDTDTDKAIDTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 8EE0E5FCB41EA455 h9l4a0_salty ssaE STM1396 protein protein salty Salmonella typhimurium MTTLTRLEDLLLHSREEAKGIILQLRAARKQLEENNGKLQDPQQYQQNTLLLEAIEQAENIINIIYYRYHNSALVVSEQE C2FC662414A04678 ssea_salty Type III secretion system chaperone SseA Secretion system effector A sseA STM1397 protein protein salty Salmonella typhimurium MMIKKKAAFSEYRDLEQSYMQLNHCLKKFHQIRAKVSQQLAERAESPKNSRETESILHNLFPQGVAGVNQEAEKDLKKIVSLFKQLEVRLKQLNAQAPVEIPSGKTKR 5C58323413648E9E ssaq_salty Secretion system apparatus protein SsaQ ssaQ STM1418 protein protein salty Salmonella typhimurium MLRIANEERPWVEILPTQGATIGELTLSMQQYPVQQGTLFTINYHNELGRVWIAEQCWQRWCEGLIGTANRSAIDPELLYGIAEWGLAPLLQASDATLCQNEPPTSCSNLPHQLALHIKWTVEEHEFHSIIFTWPTGFLRNIVGELSAERQQIYPAPPVVVPVYSGWCQLTLIELESIEIGMGVRIHCFGDIRLGFFAIQLPGGIYARVLLTEDNTMKFDELVQDIETLLASGSPMSKSDGTSSVELEQIPQQVLFEVGRASLEIGQLRQLKTGDVLPVGGCFAPEVTIRVNDRIIGQGELIACGNEFMVRITRWYLCKNTA F1A0BC9AE2F2C5AE sseb_salty Secreted effector protein SseB Secretion system effector B sseB STM1398 protein protein salty Salmonella typhimurium MSSGNILWGSQNPIVFKNSFGVSNADTGSQDDLSQQNPFAEGYGVLLILLMVIQAIANNKFIEVQKNAERARNTQEKSNEMDEVIAKAAKGDAKTKEEVPEDVIKYMRDNGILIDGMTIDDYMAKYGDHGKLDKGGLQAIKAALDNDANRNTDLMSQGQITIQKMSQELNAVLTQLTGLISKWGEISSMIAQKTYS CD38B8995323DF67 atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ssan-ssan-1 1 6 unspecified role unspecified role prey prey 2ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 ssan-ssaq-1 1 9 unspecified role unspecified role prey prey 2ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 ssan-ssak-1 1 4 unspecified role unspecified role prey prey 2ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 ssan-ssca-1 1 5 unspecified role unspecified role prey prey 2ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 ssan-sscb-1 1 3 unspecified role unspecified role prey prey 2ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 ssan-ssae-1 1 7 unspecified role unspecified role prey prey 2ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 ssan-ssea-1 1 8 unspecified role unspecified role prey prey 2ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 ssae-sseb-2 1 10 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 6 ssan-1 2 6 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate unspecified role unspecified role atpase reaction atpase reaction 3E-F