MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures. EMBO Rep. (1469-221X) 2014 imex curation Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lystad A.H., Ichimura Y., Takagi K., Yang Y., Pankiv S., Kanegae Y., Kageyama S., Suzuki M., Saito I., Mizushima T., Komatsu M., Simonsen A. komatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.nok omatsu-ms@igakuken.or.jp,anne.simonsen@medisin.uio.no anne.simonsen@medisin.uio.no; komatsu-ms@igakuken.or.jp Accepted 2015-FEB-24 by MARTA EMBO Rep. (1469-221X) 2014 Only protein-protein interactions imex curation gbrl2_human Gamma-aminobutyric acid receptor-associated protein-like 2 GABA(A) receptor-associated protein-like 2 Golgi-associated ATPase enhancer of 16 kDa General protein transport factor p16 Ganglioside expression factor 2 MAP1 light chain 3-related protein GABARAPL2 FLC3A GEF2 protein protein human Homo sapiens Human MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF DIP protein P60520 original sequence version: 93 DIP protein P60520 original sequence version: 112 17ACB540FD5B975B mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F mlp3c_human Microtubule-associated proteins 1A/1B light chain 3C MAP1LC3C Microtubule-associated protein 1 light chain 3 gamma MAP1A/MAP1B light chain 3 C MAP1 light chain 3-like protein 3 Autophagy-related protein LC3 C Autophagy-related ubiquitin-like modifier LC3 C protein protein human Homo sapiens Human MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLEDRPCNPL DIP protein Q9BXW4 original sequence version: 92 DIP protein Q9BXW4 original sequence version: 111 D3DFA8EE5985C3AA wdfy3_human WD repeat and FYVE domain-containing protein 3 Autophagy-linked FYVE protein WDFY3 KIAA0993 protein protein human Homo sapiens Human MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNRVFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEASRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLAERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLMTISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTLLDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVSELKPAGITTGAPFLLPGFAVPQPAGKGHSVRNVQAFAVLQNAFLKAKTSFLAQIILDAITNIYMADNANYFILESQHTLSQFAEKISKLPEVQNKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSIIAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHLALLVMETLTVLLQGSNTNAGIFREFGGARCAHNIVKYPQCRQHALMTIQQLVLSPNGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVAMERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVISIESVSPTLRHCSKLFIYLYKVATDSFDSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPPKNVADLKLHVTTSSLQSSDAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANILQSLVHTERNQQVMCEAGLHARLLQRCSAALADEDHSLHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLLKQYRVHKPSSLSYEPEMRSSMITSLEGLGTDNVFSLHEDNHYRISKSLVKSAEGSTVPLTRVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNTVTTGLIDGAVVSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRLLTVVRRANSSEQHYVCLAIVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIIEGQWHHLVLVMSKGMLKNSTAALYIDGQLVNTVKLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRQIASLVWRLGPTHFLEEVLPSSNVTTIYELGPNYVGSFQAVCMPCKDAKSEGVVPSPVSLVPEEKVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLIHNSAGHLNGSARTIGAALIGYLGVRTFVPKPVATTLQYVGGAAAILGLVAMASDVEGLYAAVKALVCVVKSNPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQDLLCDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQPTIAAISNVLSFLLQGFPSSNDLLRFGQFISSTLPTFAVCEKFVVMEINNEEKLDTGTEEEFGGLVSANLILLRNRLLDILLKLIYTSKEKTSINLQACEELVKTLGFDWIMMFMEEHLHSTTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGRSTVREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVISCRSKQGCQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAVFLLLGMLRSMLTSPWQSEEEGSWLREYPVTLMQFFRYLYHNVPDLASMWMSPDFLCALAATVFPFNIRPYSEMVTDLDDEVGSPAEEFKAFAADTGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVLIIDNLCLTPASKQTPLIDLLLEASPERSTRTQQKEFQTYILDSVMDHLLAADVLLGEDASLPITSGGSYQVLVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTILYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDGFGLEAEARMTTWHIMIPSDIEPDGSYSQDISEGRQLLIKAVNRVWTELIHSKKQVLEELFKVTLPVNERGHVDIATARPLIEEAALKCWQNHLAHEKKCISRGEALAPTTQSKLSRVSSGFGLSKLTGSRRNRKESGLNKHSLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYVTEEWCQIECELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPETEQETNVASEIPSKQPETPDDIPQKKPARYRRAVSYDSKEYYMRLASGNPAIVQDAIVESSEGEAAQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGDEENQEQLQDQIAEGSSIEEEEKTDNATLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIETLPPNMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQTDERLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDNAGISVLPGSTSDKIFFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLSCRLGTYESDKAMTVYECLSEWGQILCAICPNPKLVITGGTSTVVCVWEMGTSKEKAKTVTLKQALLGHTDTVTCATASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINELTGDIVSCAGTYIHVWSINGNPIVSVNTFTGRSQQIICCCMSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPAPEPAEVLEMQEDCPEAQIGQEAQDEDSSDSEADEQSISQDPKDTPSQPSSTSHRPRAASCRATAAWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEVTALGISKDHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERGSEDGPRNC F4D518E8C9C12E23 gbrl1_human Gamma-aminobutyric acid receptor-associated protein-like 1 GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1 Early estrogen-regulated protein GABARAPL1 GEC1 protein protein human Homo sapiens Human MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK DIP protein Q9H0R8 original sequence version: 129 7F56E345255F564B q6iaw1_human GABARAP hCG_1987397 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL BC0B84B8A51C1E32 sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q13501 original sequence version: 139 DIP protein Q13501 original sequence version: 142 DIP protein Q13501 original sequence version: 163 DIP protein Q13501 original sequence version: 146 DIP protein Q13501 original sequence version: 162 DIP protein Q13501 original sequence version: 155 DIP protein Q13501 original sequence version: 140 462D94C171F337CD mlp3b_mouse Microtubule-associated proteins 1A/1B light chain 3B Map1lc3b Map1alc3 Map1lc3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein mouse Mus musculus Mouse MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV DIP protein Q9CQV6 original sequence version: 118 DIP protein Q9CQV6 original sequence version: 123 mint Probably involved in formation of autophagosomal vacuoles (autophagosomes) 520E29028163FA8D gbrap_mouse Gamma-aminobutyric acid receptor-associated protein Gabarap GABA(A) receptor-associated protein protein protein mouse Mus musculus Mouse MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL BC0B84B8A51C1E32 map1lc3c-wdfy3 3 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a map1lc3c-wdfy3-1 3 16 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1a gabarap-wdfy3 3 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 15 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true physical association physical association f1a gabarapl1-wdfy3 3 11 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1a wdfy3-gabarap-1 7 16 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true Q8IZQ1:p.Phe3346Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 17:10:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3346ala' Tue Jun 30 17:18:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3346Ala' physical association physical association sf1a sf1b sf1c wdfy3-gabarap-2 7 16 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true Q8IZQ1:p.Val3349Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true V A Wed May 02 14:48:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val3349ala' Tue Jun 30 20:06:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val3349Ala' physical association physical association sf1a sf1b sf1c wdfy3-gabarap-3 8 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f1c wdfy3-gabarap-4 9 16 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f1d gabarap-wdfy3-1 9 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 11 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f1d gabarapl2-wdfy3 9 15 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f1d gabarapl1-wdfy3-1 9 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f1d gabarap-wdfy3-15 10 16 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction sf1d f2d wdfy3-gabarap-5 10 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 13 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf1d f2d wdfy3-map1lc3c 10 15 unspecified role unspecified role neutral component neutral component purified purified 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction sf1d f2d gabarapl2-wdfy3-1 10 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 11 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf1d f2d wdfy3-gabarap-1 8 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q8IZQ1:p.Phe3346Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:48:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3346ala' Tue Jun 30 16:57:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3346Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f2b gabarap-wdfy3-3 8 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q8IZQ1:p.Ile3347Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true I A Wed May 02 14:44:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile3347ala' Tue Jun 30 20:08:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile3347Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f2b gabarap-wdfy3-4 8 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q8IZQ1:p.Phe3348Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true F A Wed May 02 18:15:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3348ala' Tue Jun 30 18:27:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3348Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f2b gabarap-wdfy3-5 8 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q8IZQ1:p.Val3349Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true V A Wed May 02 17:44:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val3349ala' Tue Jun 30 18:08:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val3349Ala' gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f2b wdfy3-gabarap-1 4 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified Q8IZQ1:p.Phe3346Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true F A Wed May 02 17:14:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3346ala' Tue Jun 30 19:31:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3346Ala' mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f2c gabarap-wdfy3-6 5 16 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f3a sf2a sf2b st1 map1lc3c-sqstm1-2 2 17 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true Q9BXW4:p.[Val26Lys;Ala27Tyr;Lys57Asp] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V K certain certain sequence position certain certain certain sequence position certain A Y certain certain sequence position certain certain certain sequence position certain K D Wed May 02 18:16:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val26lys,ala27tyr,lys57asp' Tue Jun 30 16:03:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val26Lys;Ala27Tyr;Lys57Asp]' 14 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f3d wdfy3-gabarap-1 4 16 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6IAW1:p.[Lys24Gln;Tyr25His;Asp54His] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain Y H certain certain sequence position certain certain certain sequence position certain D H Wed May 02 16:23:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys24gln,tyr25his,asp54his' Tue Jun 30 19:16:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys24Gln;Tyr25His;Asp54His]' 14 anti tag western anti tag western blot anti tag western weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f3e f3f wdfy3-gabarap-1 4 16 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified Q6IAW1:p.[Lys24Gln;Tyr25His;Asp54His] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true K Q certain certain sequence position certain certain certain sequence position certain true Y H certain certain sequence position certain certain certain sequence position certain true D H Wed May 02 14:58:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys24gln,tyr25his,asp54his' Tue Jun 30 19:45:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys24Gln;Tyr25His;Asp54His]' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 anti tag western anti tag western blot anti tag western weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified Q8IZQ1:p.Phe3346Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:27:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3346ala' Tue Jun 30 17:15:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3346Ala' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f3f wdfy3-gabarap-1 4 17 anti tag western anti tag western blot anti tag western weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified Q13501:p.His340Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true H A Wed May 02 15:09:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his340ala' Tue Jun 30 18:26:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His340Ala' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 12 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f3f sqstm1-gabarap 4 17 anti tag western anti tag western blot anti tag western weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true Q13501:p.His340Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true H A Wed May 02 17:10:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his340ala' Tue Jun 30 17:28:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His340Ala' mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 16 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f3f wdfy3-gabarap-1 4 14 anti tag western anti tag western blot anti tag western weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified Q8IZQ1:p.Phe3346Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true F A Wed May 02 19:11:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3346ala' Tue Jun 30 17:47:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3346Ala' mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 16 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f3f wdfy3-gabarap-1 4 14 anti tag western anti tag western blot anti tag western weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true Q8IZQ1:p.Phe3346Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true F A Wed May 02 18:00:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3346ala' Tue Jun 30 18:06:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3346Ala' 12 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified Q9GZQ8:p.[Gln26Lys;His27Tyr;His57Asp] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q K certain certain sequence position certain certain certain sequence position certain H Y certain certain sequence position certain certain certain sequence position certain H D Wed May 02 15:12:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln26lys,his27tyr,his57asp' Tue Jun 30 19:28:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln26Lys;His27Tyr;His57Asp]' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f3f gabarap-wdfy3-7 8 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true Q8IZQ1:p.[Lys3343Ala;Asp3344Ala;Tyr3351Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true K A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:23:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys3343ala,asp3344ala,tyr3351ala' Tue Jun 30 17:34:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys3343Ala;Asp3344Ala;Tyr3351Ala]' 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f3g gabarap-wdfy3-8 1 16 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f4a We here show that endogenous LC3B (Supplementary Fig S3), as well as stably expressed GFP-GABARAP (Fig 4A), colocalized with endoge- nous ALFY in stress-induced cytoplasmic structures. gabarap-wdfy3-9 1 12 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 14 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization sf3 We here show that endogenous LC3B (Supplementary Fig S3), as well as stably expressed GFP-GABARAP (Fig 4A), colocalized with endoge- nous ALFY in stress-induced cytoplasmic structures. gabarap-map1lc3b 1 12 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 16 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell mcherry tag mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain colocalization colocalization sf5b while overexpressed ALFY2285–3526 did not colocalize with wild-type GFP- LC3B, colocalization was observed upon the induction of excess GABARAP (Supplementary Fig S5B) or expression of the GFP-LC3B (Q26K/H27Y/H57D) mutant (Supplementary Fig S5B), indicating that the structural determinants identified as being important for GABARAP-ALFY binding specificity also determine colocalization between these proteins. gabarap-map1lc3b-1 1 14 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true mcherry tag mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 12 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9GZQ8:p.[Gln26Lys;His27Tyr;His57Asp] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q K certain certain sequence position certain certain certain sequence position certain H Y certain certain sequence position certain certain certain sequence position certain H D Wed May 02 14:34:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln26lys,his27tyr,his57asp' Tue Jun 30 19:16:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln26Lys;His27Tyr;His57Asp]' colocalization colocalization sf5b while overexpressed ALFY2285–3526 did not colocalize with wild-type GFP- LC3B, colocalization was observed upon the induction of excess GABARAP (Supplementary Fig S5B) or expression of the GFP-LC3B (Q26K/H27Y/H57D) mutant (Supplementary Fig S5B), indicating that the structural determinants identified as being important for GABARAP-ALFY binding specificity also determine colocalization between these proteins. gabarap-wdfy3-10 6 19 immunostaining immunostaining anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 14 tag fluorescence tag visualisation by fluorescence tag fluorescence anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization sf4 We here show that endogenous LC3B (Supplementary Fig S3), as well as stably expressed GFP-GABARAP (Fig 4A), colocalized with endoge- nous ALFY in stress-induced cytoplasmic structures. Interestingly, full-length wild-type GFP-ALFY, but not the LIR mutant, was recruited to GABARAP and LC3B-positive structures when expressed in ALFY-deficient MEFs (Fig 4B and Supplementary Fig S4). gabarap-wdfy3-11 6 18 immunostaining immunostaining anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 14 tag fluorescence tag visualisation by fluorescence tag fluorescence anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true colocalization colocalization sf4 We here show that endogenous LC3B (Supplementary Fig S3), as well as stably expressed GFP-GABARAP (Fig 4A), colocalized with endoge- nous ALFY in stress-induced cytoplasmic structures. Interestingly, full-length wild-type GFP-ALFY, but not the LIR mutant, was recruited to GABARAP and LC3B-positive structures when expressed in ALFY-deficient MEFs (Fig 4B and Supplementary Fig S4). gabarap-wdfy3-12 8 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true Q8IZQ1:p.Ile3347Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true I A Wed May 02 18:42:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile3347ala' Tue Jun 30 19:35:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile3347Ala' 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f2b gabarap-wdfy3-13 8 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q8IZQ1:p.Phe3348Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true F A Wed May 02 16:14:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe3348ala' Tue Jun 30 17:48:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3348Ala' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true direct interaction direct interaction f2b gabarap-wdfy3-14 8 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true Q8IZQ1:p.Val3349Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true V A Wed May 02 19:41:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val3349ala' Tue Jun 30 17:11:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val3349Ala' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f2b