MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Yeast Edc3 targets RPS28B mRNA for decapping by binding to a 3' untranslated region decay-inducing regulatory element. Yeast Edc3 targets RPS28B mRNA for decapping by binding to a 3' untranslated region decay-inducing regulatory element. Molecular and cellular biology 2014 imex curation He F., Li C., Roy B., Jacobson A. allan.jacobson@umassmed.edu Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined He F., Li C., Roy B., Jacobson A. allan.jacobson@umassmed.edu Accepted 2015-APR-29 by LUANA Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation rs28b_yeast 40S ribosomal protein S28-B RPS28B RPS33B YLR264W L8479.5 S33 YS27 Small ribosomal subunit protein eS28-B protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILVLMESEREARRLR ABF5A8353F18A641 ABF5A8353F18A641 dcp1_yeast mRNA-decapping enzyme subunit 1 DCP1 YOL149W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA 8456B1C96C121C4D 8456B1C96C121C4D edc3_yeast Enhancer of mRNA-decapping protein 3 EDC3 LSM16 YEL015W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQFVGFGVQVELKDGKLIQGKIAKATSKGLTLNDVQFGDGGKSQAFKVRASRLKDLKVLTVASQSGKRKQQRQQQQQNDYNQNRGEHIDWQDDDVSKIKQQEDFDFQRNLGMFNKKDVFAQLKQNDDILPENRLQGHNRKQTQLQQNNYQNDELVIPDAKKDSWNKISSRNEQSTHQSQPQQDAQDDLVLEDDEHEYDVDDIDDPKYLPITQSLNITHLIHSATNSPSINDKTKGTVINDKDQVLAKLGQMIISQSRSNSTSLPAANKQTTIRSKNTKQNIPMATPVQLLEMESITSEFFSINSAGLLENFAVNASFFLKQKLGGRARLRLQNSNPEPLVVILASDSNRSGAKALALGRHLCQTGHIRVITLFTCSQNELQDSMVKKQTDIYKKCGGKIVNSVSSLESAMETLNSPVEIVIDAMQGYDCTLSDLAGTSEVIESRIKSMISWCNKQRGSTKVWSLDIPNGFDAGSGMPDIFFSDRIEATGIICSGWPLIAINNLIANLPSLEDAVLIDIGIPQGAYSQRTSLRKFQNCDLFVTDGSLLLDL BF28AE67F9303A73 BF28AE67F9303A73 1-42 1 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f5 edc3-rps28b-1 1 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f5