IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1). Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1). FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de Only protein-protein interactions human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de F.T.,frank.thevenod@ uni-wh.de Accepted 2015-JUN-17 by ORCHARD FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1). Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1). FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de F.T.,frank.thevenod@ uni-wh.de Accepted 2015-JUN-17 by ORCHARD Human kidney NubG-x cDNA FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1). Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1). FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de Only protein-protein interactions human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wolff NA., Ghio AJ., Garrick LM., Garrick MD., Zhao L., Fenton RA., Thévenod F. frank.thevenod@uni-wh.de,natascha.wolff@uni-wh.de F.T.,frank.thevenod@ uni-wh.de Accepted 2015-JUN-15 by ORCHARD FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation p49281-3 Natural resistance-associated macrophage protein 2 Divalent cation transporter 1 Divalent metal transporter 1 Solute carrier family 11 member 2 OK/SW-cl.20 1A-IRE SLC11A2 DCT1 DMT1 NRAMP2 protein protein human Homo sapiens Human MRKKQLKTEAAPHCELKSYSKNSATQVSTMVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQVNRNNKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAGGILVLIICSINMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDCGHTVSISKGLLTEEATRGYVK E3519A0770B89737 cox2_human Cytochrome c oxidase subunit 2 MT-CO2 COII COXII MTCO2 Cytochrome c oxidase polypeptide II COX2 protein protein human Homo sapiens Human MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL DIP protein P00403 original sequence version: null 402A3145241DDEE6 tom6_human Mitochondrial import receptor subunit TOM6 homolog TOMM6 Overexpressed breast tumor protein Translocase of outer membrane 6 kDa subunit homolog OBTP TOM6 protein protein human Homo sapiens Human MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV 805462C0444865FD nram2_human Natural resistance-associated macrophage protein 2 SLC11A2 DCT1 DMT1 NRAMP2 Divalent cation transporter 1 Divalent metal transporter 1 Solute carrier family 11 member 2 OK/SW-cl.20 protein protein human Homo sapiens Human MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQVNRNNKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAGGILVLIICSINMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR DIP protein P49281 original sequence version: 97 4E45D6A448A23263 dmt1-coxll-1 2 5 unspecified role unspecified role prey prey NubG-xprey NubG-x-Cox2 nub nub n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 2 dmt1-tom6-1 2 6 unspecified role unspecified role prey prey n-terminal nub nub n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 2 dmt1-1-cox2-1 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig 2B slc11a2-mt_co2-2 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminus DMT1-1A/+IRE-flag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 2D