UniProt UniProt http://www.uniprot.org Targeting γ-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy. Targeting γ-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy. The Journal of biological chemistry 2014 imex curation Su M., Mei Y., Sanishvili R., Levine B., Colbert CL., Sinha S. Sangita.Sinha@ndsu.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Su M., Mei Y., Sanishvili R., Levine B., Colbert CL., Sinha S. Beclin-1synthesized peptides according Ref.22 (PMID 18797192) Sangita.Sinha@ndsu.edu Accepted 2015-NOV-05 AT 15:40 GMT AT 15:40 GMT by ORCHARD The Journal of biological chemistry 2014 IMEx imex curation Targeting γ-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy. Targeting γ-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy. The Journal of biological chemistry 2014 imex curation Su M., Mei Y., Sanishvili R., Levine B., Colbert CL., Sinha S. Sangita.Sinha@ndsu.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Su M., Mei Y., Sanishvili R., Levine B., Colbert CL., Sinha S. Sangita.Sinha@ndsu.edu Accepted 2015-NOV-05 AT 15:40 GMT AT 15:40 GMT by ORCHARD The Journal of biological chemistry 2014 IMEx imex curation becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C arbh_mhv68 Apoptosis regulator Bcl-2 homolog vBCL2 Protein M11 protein protein mhv68 Murid herpesvirus 4 (MuHV-4) Murine gammaherpesvirus 68 MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVLPRIYSGNVIYV 43937262635E3446 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE becn1-v_bcl_2-1 1 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component bh3_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14457:p.Leu112Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Kd 4.38 uM Wed May 02 15:08:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu112ala' Tue Jun 30 17:39:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu112Ala' Q14457:p.Leu116Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A kD 177 uM Wed May 02 17:00:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116ala' Tue Jun 30 19:17:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu116Ala' Q14457:p.Gly120Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G E Kd 36.49 uM Wed May 02 20:03:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly120glu' Tue Jun 30 20:06:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120Glu' Q14457:p.Phe123Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F A Kd 5.20 uM Wed May 02 19:14:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe123ala' Tue Jun 30 17:02:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe123Ala' Q14457:p.Lys117Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:46:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys117ala' Tue Jun 30 15:44:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys117Ala' Q14457:p.Gly120_Asp121delinsGluAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain GD EA Kd 6.43 uM Fri Jul 22 11:07:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_asp120-121asp_ala' Wed May 02 17:18:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_asp120-121glu_ala' Wed May 02 20:27:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_asp120-121glu_ala' Tue Jun 30 17:21:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120_Asp121delinsGluAla' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Table 3 bcl2l1-becn1-4 1 3 unspecified role unspecified role neutral component neutral component Q14457:p.Asp121Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:11:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp121ala' Tue Jun 30 19:22:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp121Ala' bh3_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14457:p.Leu112Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Kd 109.71 uM Wed May 02 17:31:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu112ala' Tue Jun 30 20:06:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu112Ala' Q14457:p.Leu116Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:13:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116ala' Tue Jun 30 19:20:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu116Ala' Q14457:p.Gly120Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G E Wed May 02 15:41:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly120glu' Tue Jun 30 20:09:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120Glu' Q14457:p.Phe123Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F A Kd 407.56 uM Wed May 02 14:39:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe123ala' Tue Jun 30 18:08:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe123Ala' Q14457:p.Lys117Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:37:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys117ala' Tue Jun 30 19:31:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys117Ala' Q14457:p.Gly120_Asp121delinsGluAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain GD EA Fri Jul 22 11:11:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_asp120-121asp_ala' Wed May 02 19:11:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_asp120-121glu_ala' Tue Jun 30 19:25:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120_Asp121delinsGluAla' chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q07817-1:p.[Asn52Asp;Asn66Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain N D certain certain sequence position certain certain certain sequence position certain N D Fri Jul 22 11:02:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asn52asp_asn66asp' Wed May 02 16:47:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn52asp,asn66asp' Tue Jun 30 18:29:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn52Asp;Asn66Asp]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 3 Q14457 inhibits activity of Q07817 becn1-v_bcl_2-2 2 3 unspecified role unspecified role neutral component neutral component bh3_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14457:p.Gly120_Asp121delinsGluAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain GD EA Kd 6.43 uM Fri Jul 22 10:54:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_asp120-121asp_ala' Wed May 02 17:28:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_asp120-121glu_ala' Tue Jun 30 18:53:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120_Asp121delinsGluAla' 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 33 36 direct interaction direct interaction 4A Rfree=22.4%, Rworking=16.0%. 2.1 A