UniProt UniProt http://www.uniprot.org Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Biochemical and biophysical research communications 2013 imex curation Mori Y., Matsui T., Omote D., Fukuda M. Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). nori@tohoku.ac.jp Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mori Y., Matsui T., Omote D., Fukuda M. nori@tohoku.ac.jp Accepted 2015-MAY-12 by MGT mouse testis and embryo mixed cDNA libraries Biochemical and biophysical research communications 2013 IMEx mimix curation Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Biochemical and biophysical research communications 2013 imex curation Mori Y., Matsui T., Omote D., Fukuda M. Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). nori@tohoku.ac.jp Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mori Y., Matsui T., Omote D., Fukuda M. nori@tohoku.ac.jp Accepted 2015-MAY-12 by MGT Biochemical and biophysical research communications 2013 IMEx mimix curation Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Biochemical and biophysical research communications 2013 imex curation Mori Y., Matsui T., Omote D., Fukuda M. Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). nori@tohoku.ac.jp Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mori Y., Matsui T., Omote D., Fukuda M. nori@tohoku.ac.jp Accepted 2015-MAY-12 by MGT Biochemical and biophysical research communications 2013 IMEx mimix curation Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Small GTPase Rab39A interacts with UACA and regulates the retinoic acid-induced neurite morphology of Neuro2A cells. Biochemical and biophysical research communications 2013 imex curation Mori Y., Matsui T., Omote D., Fukuda M. Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). nori@tohoku.ac.jp Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Mori Y., Matsui T., Omote D., Fukuda M. Mouse UACA has been mapped to Uaca isoform 3 according to the seq length given in the publication (fig1A). Origin of Rab39A and Rab39B constructs according ref 19 (pmid 16923123). nori@tohoku.ac.jp Accepted 2015-MAY-12 by MGT Biochemical and biophysical research communications 2013 imex curation mimix curation rb39b_mouse Ras-related protein Rab-39B Rab39b protein protein mouse Mus musculus Mouse MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVIKSERRCLC 338F5B35C61FA88E q8cgb3-3 Uveal autoantigen with coiled-coil domains and ankyrin repeats Nuclear membrane-binding protein Uaca Kiaa1561 protein protein mouse Mus musculus Mouse MKSLKSRLWKQDAPGPTSPSSPTAVASTQSAEWNKYDDRLMKAAERGDVEKVSSILAKKGVHPGKLDVEGRSAFHVVASKGNLECLNAILTHGIDVATRDSAGRNALHLAAKYGHALCLQKLLQYNCPTEHVDLQGRTALHDAVMADCPSSIQLLCDHGASVNAKDIDGRTPLVLATQMCRPTICQLLIDRGADVNSRDKQNRTALMLGCEYGCRDAVEVLVKNGADLTLLDALGHDSSYYARIGDNLDILNLLKTASENTNKGGGRELWRKGPPLQQRNLSHTQDEGSVKSTQREQREPHSFQDLEIENEDLREKLRKIQQEQRILLDKVNGLQLQLNEEVMVADDLESEREKPKSLLAAKEKQHEESLRTIEALKNRFKYFESDHPGPGSYPSNRKEDMLHKQGQMYTTEPQCASPGIPPHMHSRSMLRPLELSLPSQTSYSENEILKKELETLRTYYDSAKQDRLKFQNELAHKVAECKALALECERVKEDSDEQIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTNEAATGSHRIIEELREQLKDLKGKYEGASAEVGKLRSQIKQSEMLVGEFKRDEGRLVEENKRLQKECGTCEVELERRGRRVVELEGQLKELGAKLALSVPTEKFESMKSSLSNDINEKVKRLAEVGRDYESAQGEIRQLKRDLESVRAQHIRPEEHEQLRSRLEQKSGELGKKVSELTLKNQTLQKDVEKLHADNKLLNQQVHSLTVEMKTRYVPLRVSEEMKRSHDVNVEDLNKKLSEATQRYAEKKQEAERLLAENDKLTKNVSRLEAVFVAPEKHEKELMGLKSNIAELKKQLSELNKKCGEGQEKIRALMSENSSLKKTLSSQYVPAKTHEEVKASLNSTVEKTNRALLEAKKRFDDTSQEVSKLRDENEVLRRNLENVQNQMKADYVSLEEHSRRMSTVSQSLKEAQEANAAILADHRQGQEEIVSLHAEIKAQKKELDTIQECIKLKYAPLARLEECERKFKATEKGLKEQLSEQTHKCRQRDEEVKKGKQENERLRADLAALQKELQDRNALAEEAREAERALSGKADELSKQLKDLSQKYSDVKSEREKLVEEKAKQASEILAAQNLLQKQPVPLEQVEALKKSLNGTIEQLKEELRSKQRCLEREQQTVSQLQQLLENQKNSSVTLAEHLKLKEALEKEVGIMKASLREKEEESQKKTKEVSKLQTEVQTTKQALKNLETREVVDMSKYKATKNDLETQISNLNDKLASLNRKYDQACEEKVSAKDEKELLHLSIEQEIRDQKERCDKSLTTIMELQQRIQESAKQIEAKDNKITELLNDVERLKQALNGLSQLTYSSGSPTKRQSQLVDTLQQRVRDLQQQLADADRQHQEVIAIYRTHLLSAAQGHMDEDVQAALLQIIQMRQGLVC No experimental confirmation available. 89FA7474FDE59D5C rb39a_mouse Ras-related protein Rab-39A Rab39a Rab39 protein protein mouse Mus musculus Mouse METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSREEAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC 311A00AC545C4CE6 rab39b-uaca-1 1 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 14:29:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln68leu' Tue Jun 30 18:51:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln68Leu' physical association physical association 1A rab39b-uaca-2 3 5 unspecified role unspecified role bait bait Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:26:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln68leu' Tue Jun 30 18:09:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln68Leu' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BHC1:p.Ser22Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 17:51:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser22asn' Tue Jun 30 16:36:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser22Asn' 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1b and C rab39a-uaca-1 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BHD0:p.Gln72Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 16:53:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln72leu' Tue Jun 30 16:07:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln72Leu' Q8BHD0:p.Ser22Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S N Wed May 02 18:57:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser22asn' Tue Jun 30 16:17:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser22Asn' 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1B and C uaca-rab39a-1 2 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BHD0:p.Gln72Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 19:48:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln72leu' Tue Jun 30 16:21:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln72Leu' Q8BHD0:p.Ser22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Wed May 02 14:49:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser22asn' Tue Jun 30 19:06:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser22Asn' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D rab39b-uaca-4 2 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:51:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln68leu' Tue Jun 30 16:21:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln68Leu' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BHC1:p.Ser22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Wed May 02 20:02:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser22asn' Tue Jun 30 19:12:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser22Asn' 6 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D uaca-rab39a-2 4 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8BHD0:p.Gln72Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:03:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln72leu' Tue Jun 30 19:32:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln72Leu' rmstrawberry rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component n_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 2, Supp 1C. rab39b-uaca-3 4 5 unspecified role unspecified role neutral component neutral component rmstrawberry rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8BHC1:p.Gln68Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:03:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln68leu' Tue Jun 30 16:31:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln68Leu' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component n_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 2D, Supp 1C.