UniProt UniProt http://www.uniprot.org CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-lcl Human-lymphoblastoid cell line,EBV transformed B lymphocytes lcl lcl-lymphoblastoid cell line,EBV transformed B lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. EBV-immortalized B lymphocytes from individuals affected by XLID (X-linked intellectual disability) and in some instances carrying the CCDC22 T17A mutation. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. CCDC22 deficiency in humans blunts activation of proinflammatory NF-κB signaling. J. Clin. Invest. (0021-9738) 2013 imex curation Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Starokadomskyy P., Gluck N., Li H., Chen B., Wallis M., Maine G.N., Mao X., Zaidi I.W., Hein M.Y., McDonald F.J., Lenzner S., Zecha A., Ropers H.H., Kuss A.W., McGaughran J., Gecz J., Burstein E. Origin of transfected SKP1, CUL1, CUL3 and CUL5 according ref 16 (pubmed 21778237). Species origin of transfected beta-TrCP1 (Fig 6b) cannot be established from the publication, hence no results using this construct have been annotated. Origins of COMMD proteins found from reference 1 (Burstein et al., -2005) and following up further references within. ezra.burstein@utsouthwestern.edu Accepted 2015-FEB-25 by MGT J. Clin. Invest. (0021-9738) 2013 Only protein-protein interactions imex curation comd1_human COMM domain-containing protein 1 COMMD1 C2orf5 MURR1 Protein Murr1 protein protein human Homo sapiens Human MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN 9C810AECA67011DC cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA comd3_human COMM domain-containing protein 3 Protein Bup Protein PIL COMMD3 BUP C10orf8 protein protein human Homo sapiens Human MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL AC757941FC17F757 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 comda_human COMM domain-containing protein 10 COMMD10 HSPC305 PTD002 protein protein human Homo sapiens Human MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT 4D3C014FE59188CB comd9_human COMM domain-containing protein 9 COMMD9 HSPC166 protein protein human Homo sapiens Human MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK 54DA2FE525C3A24F comd5_human COMM domain-containing protein 5 COMMD5 HT002 Hypertension-related calcium-regulated gene protein protein protein human Homo sapiens Human MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD C4CC0563B9FA3240 cul2_human Cullin-2 CUL2 protein protein human Homo sapiens Human MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA DIP protein Q13617 original sequence version: 129 DIP protein Q13617 original sequence version: 127 DIP protein Q13617-1 original sequence version: 139 DIP protein Q13617 original sequence version: 111 DIP protein Q13617 original sequence version: 102 30647248F671AB0E ccd22_human Coiled-coil domain-containing protein 22 CCDC22 CXorf37 JM1 protein protein human Homo sapiens Human MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLAMSARFRLAMSLAQACMDLGYPLELGYQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVASLLEHHALQLCQQTGRDRPGDEDWVHRTSRLPPQEDTRAQRQRLQKQLTEHLRQSWGLLGAPIQARDLGELLQAWGAGAKTGAPKGSRFTHSEKFTFHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEEVEADMKTLGVSFVQAESECRHSKLSTAEREQALRLKSRAVELLPDGTANLAKLQLVVENSAQRVIHLAGQWEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLMSELETLPRDVSRLAYTQRILEIVGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTDELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTIEDTGTIMREVRDLEEQIETELGKKTLSNLEKIREDYRALRQENAGLLGRVREA C3704BBCD9EA0386 skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK C794D62AFB75528A birc3_human_gene Human BIRC3 gene gene gene human Homo sapiens Human comd4_human COMM domain-containing protein 4 COMMD4 protein protein human Homo sapiens Human MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 7B7B85234E3FB59B comd8_human COMM domain-containing protein 8 COMMD8 MDS022 protein protein human Homo sapiens Human MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK 59B48D6D7CECCCC7 ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 98D88696E883538B comd7_human COMM domain-containing protein 7 COMMD7 C20orf92 protein protein human Homo sapiens Human MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC 41D483117729B495 comd2_human COMM domain-containing protein 2 COMMD2 HSPC042 My004 protein protein human Homo sapiens Human MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK ECB4B7C26FCEA0F2 cul3_human Cullin-3 CUL3 KIAA0617 protein protein human Homo sapiens Human MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA DIP protein Q13618 original sequence version: 140 DIP protein Q13618 original sequence version: 163 DIP protein Q13618 original sequence version: 121 DIP protein Q13618 original sequence version: 161 A1A02022480BF099 cul5_human Cullin-5 CUL5 VACM1 Vasopressin-activated calcium-mobilizing receptor 1 protein protein human Homo sapiens Human MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA DIP protein Q93034 original sequence version: 160 DIP protein Q93034 original sequence version: 128 DIP protein Q93034 original sequence version: 126 DIP protein Q93034 original sequence version: 142 DIP protein Q93034 original sequence version: 96 57463CB4ED76E303 comd6_human COMM domain-containing protein 6 COMMD6 MSTP076 protein protein human Homo sapiens Human MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV FBF29F240EA8756B commd1-ccdc22 10 22 unspecified role unspecified role prey prey cell lysate cell lysate 19 unspecified role unspecified role prey prey cell lysate cell lysate 30 unspecified role unspecified role prey prey cell lysate cell lysate 13 unspecified role unspecified role prey prey cell lysate cell lysate 11 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ha_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 1A commd9-ccdc22 10 16 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ha_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role prey prey cell lysate cell lysate 17 unspecified role unspecified role prey prey cell lysate cell lysate 19 unspecified role unspecified role prey prey cell lysate cell lysate 30 unspecified role unspecified role prey prey cell lysate cell lysate association association 1A commd10-ccdc22 10 30 unspecified role unspecified role prey prey cell lysate cell lysate 17 unspecified role unspecified role prey prey cell lysate cell lysate 16 unspecified role unspecified role prey prey cell lysate cell lysate 19 unspecified role unspecified role prey prey cell lysate cell lysate 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ha_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 1A ccdc22-commd1-1 3 19 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1B and S6B Association has been found with or without TNF treatment commd6-ccdc22 3 30 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 1C commd1-ccdc22-1 3 11 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey association association 1C commd9-ccdc22-1 3 16 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 1C commd10-ccdc22-1 3 19 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 1C commd1-ccdc22-2 6 19 unspecified role unspecified role prey prey cell lysate cell lysate 11 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection comm_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D and 3C commd2-ccdc22 6 27 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 1D commd3-ccdc22 6 13 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 1D commd4-ccdc22 6 22 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 1D commd5-ccdc22 6 19 unspecified role unspecified role prey prey cell lysate cell lysate 17 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D commd6-ccdc22-1 6 19 unspecified role unspecified role prey prey cell lysate cell lysate 30 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D commd7-ccdc22 6 19 unspecified role unspecified role prey prey cell lysate cell lysate 26 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D commd8-ccdc22 6 23 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 1D commd9-ccdc22-2 6 16 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 1D commd10-ccdc22-2 6 19 unspecified role unspecified role prey prey cell lysate cell lysate 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D ccdc22-commd1-2 4 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait c-terminus lap tag lap tag lap tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 1E ccdc22-commd1-3 4 23 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait n-terminus lap tag lap tag lap tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association S2 ccdc22-commd1-4 8 11 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2A commd6-commd1-1 3 15 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association 2B Association not dependent on presence of CCDC22 (siRNA for CCDC22 transfected) ccdc22-commd1-5 6 11 unspecified role unspecified role unspecified role unspecified role 19 unspecified role unspecified role unspecified role unspecified role nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3B commd1-ccdc22-3 7 11 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey O60826:p.Thr17Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A Variant found in a family affected by mental retardation; UniProt FTId: VAR_065912 Wed May 02 18:45:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17ala' Tue Jun 30 17:02:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Ala' A CCDC22 variant glu239lys also interacts physical association physical association 3 D/F commd1-ccdc22-4 1 11 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey O60826:p.Thr17Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true T A Variant found in a family affected by mental retardation; UniProt FTId: VAR_065912 Wed May 02 17:26:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17ala' Tue Jun 30 17:33:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Ala' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CCDC22 variants thr30ala, arg128fln, glu239lys, arg321gln also interact physical association physical association 3 E/G cul1-ccdc22 2 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 6B skp1-ccdc22 2 20 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 6B ccdc22-cul1 3 19 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association 6C ccdc22-commd1-7 3 11 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 6D CUL1 or CUL2 have not been required for the association commd1-cul2-2 6 18 unspecified role unspecified role prey prey cell lysate cell lysate 11 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6E CCDC22 has not been required for the association commd8-commd1-1 6 11 unspecified role unspecified role prey prey cell lysate cell lysate 12 unspecified role unspecified role prey prey cell lysate cell lysate 28 unspecified role unspecified role prey prey cell lysate cell lysate 23 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6E CCDC22 has not been required for the association cul2-commd1-3 6 25 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection tb_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 18 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S7A commd1-ccdc22-6 6 18 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection tb_biotin_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 19 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association S7A GST-purified Cul2:COMMD1 complex (EBI-10107357) has been re-preciptitated against strep tag and blotted for endogenous CCDC22 and Elongin C. cul1-ccdc22-1 9 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S9A cul3-ccdc22 9 19 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 28 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S9A cul5-ccdc22 9 29 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true physical association physical association S9A ccdc22-birc3 5 19 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp fig 7C TNF ccdc22-birc3-1 5 21 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 11 unspecified role unspecified role bait bait association association Supp fig 7C-i TNF commd1-birc3 5 21 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 14 unspecified role unspecified role bait bait association association Supp fig 7C-ii TNF commd6-ccdc22-2 3 15 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait association association 2B rela-nfkbia-16 7 14 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey possible_phosphores phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6a In lymphoblastoid cell lines from patients with a CCDC22 thr17ala mutation, phosphorylated NFKBIA/IKBa is much less ubiquitinated compared to tissue from wildtype CCDC22.