HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Only protein-protein interactions imex curation in vitro In vitro lipase assay lipase assay predetermined predetermined participant predetermined LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Accepted 2015-MAY-13 by MGT The Journal of biological chemistry 2012 imex curation A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down tag visualisation tag visualisation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Accepted 2015-APR-15 by MGT The Journal of biological chemistry 2012 imex curation A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Accepted 2015-APR-15 by MGT The Journal of biological chemistry 2012 imex curation A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. A Salmonella typhimurium-translocated glycerophospholipid:cholesterol acyltransferase promotes virulence by binding to the RhoA protein switch regions. The Journal of biological chemistry 2012 imex curation LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI., LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined LaRock DL., Brzovic PS., Levin I., Blanc MP., Miller SI. millersi@u.washington.edu Accepted 2015-APR-15 by MGT The Journal of biological chemistry 2012 imex curation rtkn_human Rhotekin RTKN1 RTKN protein protein human Homo sapiens Human MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLAACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAGGSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRLAAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSPV DIP protein Q9BST9 original sequence version: 112 B3C64CB737E88501 guanosine 5'-[gamma-thio]triphosphate GTP-gamma-S small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) a0a0f6b1q8_salt1 STM14_1974 sseJ protein protein salt1 Salmonella typhimurium (strain 14028s / SGSC 2262) MPLSVGQGYFTSSISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVRGAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEAFGLAKEINKSHPKPKNISLGDITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSASYSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLVMGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYDTENPYTHHGYVHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYSTE 8917A5A5590566F4 p-nitrophenyl palmitate p-nitrophenyl palmitate (4-nitrophenyl) hexadecanoate 4-Nitrophenyl palmitate Hexadecanoic acid 4-nitrophenyl ester p-nitrophenyl hexadecanoate para-nitrophenyl palmitate paranitrophenyl palmitate 4-nitrophenyl hexadecanoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL DIP protein P61586 original sequence version: 86 DIP protein P61586 original sequence version: 123 DIP protein P61586 original sequence version: 57 DIP protein P61586 original sequence version: 88 DIP protein P61586 original sequence version: 87 DIP protein P61586 original sequence version: 85 DIP protein P61586 original sequence version: 125 DIP protein P61586 original sequence version: 132 C4DA2DC31FF858BC gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ssej-rhoa-1 4 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 6 cofactor cofactor coenzyme unspecified role unspecified role direct interaction direct interaction 2A rhoa-ssej-1 2 9 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P61586:p.Phe39Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 20:03:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe39ala' Tue Jun 30 15:42:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe39Ala' P61586:p.Arg68Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:26:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg68ala' Tue Jun 30 17:03:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg68Ala' P61586:p.Leu69Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:13:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69ala' Tue Jun 30 16:20:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Ala' P61586:p.Leu72Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:02:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu72ala' Tue Jun 30 17:29:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu72Ala' P61586:p.Phe106Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 17:31:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe106ala' Tue Jun 30 16:14:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe106Ala' P61586:p.Gly14Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 14:35:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly14val' Tue Jun 30 18:13:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly14Val' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B ssej-rhoa-2 3 7 unspecified role unspecified role neutral component neutral component myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A0A0F6B1Q8:p.Phe121Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F D Wed May 02 16:39:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe121asp' Tue Jun 30 20:24:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe121Asp' ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P61586:p.Gly14Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:13:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly14val' Tue Jun 30 17:09:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly14Val' ecoli Escherichia coli (strain K12) colocalization colocalization 4A and S2A rhoa-ssej-pnpp-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 6 cofactor cofactor coenzyme unspecified role unspecified role lipid cleavage lipid cleavage 1 and S1 ssej-rhoa-pnpp-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 unspecified role unspecified role ancillary ancillary his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P61586:p.Gly14Ala mutation mutation certain certain sequence position certain certain certain sequence position certain G A Wed May 02 14:42:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly14ala' Tue Jun 30 19:06:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly14Ala' P61586:p.Phe39Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F A Wed May 02 20:22:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe39ala' Tue Jun 30 18:20:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe39Ala' P61586:p.Arg68Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:08:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg68ala' Tue Jun 30 18:08:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg68Ala' P61586:p.Leu69Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:47:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69ala' Tue Jun 30 17:08:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Ala' P61586:p.Leu72Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:23:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu72ala' Tue Jun 30 19:29:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu72Ala' P61586:p.Phe106Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:30:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe106ala' Tue Jun 30 19:17:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe106Ala' P61586:p.[Phe39Ala;Leu72Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A Fri Jul 22 10:56:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu72ala,phe39ala' Wed May 02 18:12:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe39ala,leu72ala' Tue Jun 30 16:41:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe39Ala;Leu72Ala]' ecoli Escherichia coli (strain K12) 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) lipid cleavage lipid cleavage 3A and suppl table 3 ssej-rhoa-4 4 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 10 cofactor cofactor coenzyme unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2B guanosine 5'_[gamma_thio]triphosphate-pnpp-1 1 5 competitor competitor competitor unspecified role unspecified role N/A gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 6 cofactor cofactor coenzyme unspecified role unspecified role lipid cleavage lipid cleavage 1 and S1 SseJ also competes with the Rho effector binding domains, PKN1 and ROCK, for binding Rho.