UniProt UniProt http://www.uniprot.org IL-6 induction of hepatocyte proliferation through the Tmub1-regulated gene pathway. IL-6 induction of hepatocyte proliferation through the Tmub1-regulated gene pathway. International journal of molecular medicine 2012 imex curation Liu M., Liu H., Wang X., Chen P., Chen H. chenping10701@hotmail.com 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-brl-3a Rat liver BRL-3A cells Rat brl-3a rat liver BRL-3A cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu M., Liu H., Wang X., Chen P., Chen H. chenping10701@hotmail.com Accepted 2015-DEC-10 AT 14:38 GMT AT 14:38 GMT by ORCHARD International journal of molecular medicine 2012 imex curation IL-6 induction of hepatocyte proliferation through the Tmub1-regulated gene pathway. IL-6 induction of hepatocyte proliferation through the Tmub1-regulated gene pathway. International journal of molecular medicine 2012 imex curation Liu M., Liu H., Wang X., Chen P., Chen H. chenping10701@hotmail.com 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-brl-3a Rat liver BRL-3A cells Rat brl-3a rat liver BRL-3A cells confocal microscopy confocal microscopy immunostaining immunostaining Liu M., Liu H., Wang X., Chen P., Chen H. chenping10701@hotmail.com Accepted 2015-DEC-10 AT 14:38 GMT AT 14:38 GMT by ORCHARD International journal of molecular medicine 2012 imex curation camlg_rat Guided entry of tail-anchored proteins factor CAMLG Camlg Calcium signal-modulating cyclophilin ligand Caml Get2 protein protein rat Rattus norvegicus (Rat) Rat MEPMPSATDGGDRSATPSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEENQTKSKPLDSDILNPLGVPSVSKRVVLGDSVDGGVTDYQPSGGADIRGAQLGDKLDSFIKAPECSSKDGVELRQRNRGDLTADSAPRGSHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGRTTEEFDSFRIFRLVGCALLALVVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHEVLEYWGPEVP FA840DD127E3B1EF tmub1_rat Transmembrane and ubiquitin-like domain-containing protein 1 Tmub1 Hops Hepatocyte odd protein shuttling protein protein protein rat Rattus norvegicus (Rat) Rat MALIEGVGDEVTVLFSVLACLLVLALAWVSTHTTESTDPLPQSSGTTTPAQPSEAMTAIDSIREEAPGAESPSLRHRGPSAQPEPEAGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWPQDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP A83B3C4AB6C992A0 camlg-tmub1-1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 7 camlg-tmub1-2 2 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization 6