IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. The Journal of biological chemistry 2012 imex curation Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Only protein-protein interactions in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. PRE-Paramagnetic Relaxation Enhancement experiment; MTSL labeled proteins (MTSL is a paramagnetic spin label:- S-(2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-l)methyl methanesulfonothioate) were solubilized in DHPC lipid micelles. The PRE effect can influence nuclei separated by a greater distance as when compared to the Nuclear Overhauser Effect (NOE). The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Accepted 2015-APR-07 by ORCHARD The Journal of biological chemistry 2012 Only protein-protein interactions imex curation HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. The Journal of biological chemistry 2012 imex curation Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Accepted 2015-APR-07 by ORCHARD The Journal of biological chemistry 2012 Only protein-protein interactions imex curation HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. The Journal of biological chemistry 2012 imex curation Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Only protein-protein interactions in vitro In vitro solid state nmr solid state nmr ssnmr solid state nmr predetermined predetermined participant predetermined Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. BST-2 and Vpu TMDs were embedded in magnetically aligned phospholipid bicelles containing long chain (DMPC) and short chain (DHPC) phospholipids. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Accepted 2015-APR-07 by ORCHARD The Journal of biological chemistry 2012 Only protein-protein interactions imex curation HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. The Journal of biological chemistry 2012 imex curation Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Accepted 2015-APR-07 by ORCHARD The Journal of biological chemistry 2012 Only protein-protein interactions imex curation HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. HIV-1 Vpu protein antagonizes innate restriction factor BST-2 via lipid-embedded helix-helix interactions. The Journal of biological chemistry 2012 imex curation Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Only protein-protein interactions in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Skasko M., Wang Y., Tian Y., Tokarev A., Munguia J., Ruiz A., Stephens EB., Opella SJ., Guatelli J. Virus - Publications including interactions involving viral proteins This is the one curated originally by Bernd, checked by Mgt, "lost" from my dashboard, and copied to a new unassigned publication - here. So it can go straight out? Feel free to re-check if you wish - I have added/extensively altered the NMR expts. The HIV-1 VPU entry has been taken from the BH10 isolate (UniProt P69699) - see reference 7, Park et al., 2006. sopella@ucsd.edu Accepted 2015-APR-07 by ORCHARD The Journal of biological chemistry 2012 Only protein-protein interactions imex curation vpu_hv1b1 Protein Vpu U ORF protein Viral protein U vpu protein protein hv1b1 Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) HIV-1 MQPIQIAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDVDDL AB6C03F7CFEE4B51 bst2_human Bone marrow stromal antigen 2 BST2 Tetherin HM1.24 antigen protein protein human Homo sapiens Human MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ DIP protein Q10589 original sequence version: 87 DIP protein Q10589 original sequence version: 93 DIP protein Q10589 original sequence version: 92 CAF52340D69061EE bst2-vpu-2 4 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q10589:p.[Leu24_Gly25delinsIleGly;Thr45Ile] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LG IG certain certain sequence position certain certain certain sequence position certain T I Fri Jul 22 11:13:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'del-leu24,gly25_thr45ile' Wed May 02 16:29:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_gly24-25ile_gly,thr45ile' Tue Jun 30 18:51:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu24_Gly25delinsIleGly;Thr45Ile]' Q10589:p.Ile26Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I A Wed May 02 16:09:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile26ala' Tue Jun 30 18:03:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile26Ala' Q10589:p.Ile34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I A Wed May 02 14:35:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile34ala' Tue Jun 30 20:20:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile34Ala' Q10589:p.Leu37Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:42:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu37ala' Tue Jun 30 19:13:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu37Ala' Q10589:p.Leu41Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:55:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu41ala' Tue Jun 30 17:57:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu41Ala' undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:55:42 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'leu25_gly26' 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection P69699:p.Ala14Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A F Wed May 02 15:43:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala14phe' Tue Jun 30 18:15:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala14Phe' P69699:p.[Ala10Phe;Ala14Phe;Ala18Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A F certain certain sequence position certain certain certain sequence position certain A F certain certain sequence position certain certain certain sequence position certain A F Wed May 02 18:21:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala10phe,ala14phe,ala18phe' Tue Jun 30 18:47:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala10Phe;Ala14Phe;Ala18Phe]' P69699:p.Trp22Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:47:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp22ala' Tue Jun 30 17:17:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp22Ala' physical association physical association 1C, 2F, 5C Co-immunoprecipitation of Vpu with BST-2 was much less efficient when the human BST-2 protein ΔLG,T45I was expressed. human_bst2_tm-vpu-1 5 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q10589:p.Cys20Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:27:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser' Tue Jun 30 19:03:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys20Ser' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 22 25 direct interaction direct interaction 1D and E bst2-vpu-3 2 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization supplemental S1 human_bst2_tm-vpu-2 5 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P69699:p.[Ala10Phe;Ala14Phe;Ala18Phe] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A F certain certain sequence position certain certain certain sequence position certain A F certain certain sequence position certain certain certain sequence position certain A F Wed May 02 18:04:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala10phe,ala14phe,ala18phe' Tue Jun 30 16:22:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala10Phe;Ala14Phe;Ala18Phe]' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component N/A his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q10589:p.Cys20Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:02:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser' Tue Jun 30 18:19:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys20Ser' region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 33 37 direct interaction direct interaction 2A and B, 3 bst2-vpu-4 1 6 unspecified role unspecified role neutral component neutral component MTSL spin label spin label certain certain sequence position certain certain certain sequence position certain P69699:p.Gln5Cys mutation mutation certain certain sequence position certain certain certain sequence position certain Q C Wed May 02 18:10:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln5cys' Tue Jun 30 18:57:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln5Cys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component N/A his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q10589:p.Cys20Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:10:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser' Tue Jun 30 19:27:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys20Ser' region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 44 47 direct interaction direct interaction 4A -top Helices are stated to be in an anti-parallel orientation bst2-vpu-5 1 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MTSL spin label spin label certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 52 55 direct interaction direct interaction 4A-bottom helices are stated to be in an anti-parallel orientation bst2-vpu-7 3 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component tm_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 60 63 direct interaction direct interaction 4C -LHS,6B. Figure 4C:- Vpu TMD did not experience major structural or topological changes in the presence of the BST2 TMD, based on the almost perfect overlap of the spectra obtained with and without unlabeled BST-2. Fig 4A:-as far as I can see only BST2 is Val-N15 labeled, not VPU. Figure 6B:-The Delta-LG 24-25,T45I BST-2 TMD mutant induced chemical shift changes in the spectrum of the Vpu TMD that were similar to those induced by the wild type BST-2 TMD (see Figure 1D-EBI-10690892)