UniProt UniProt http://www.uniprot.org Ubiquitin ligase activity of Cul3-KLHL7 protein is attenuated by autosomal dominant retinitis pigmentosa causative mutation. Ubiquitin ligase activity of Cul3-KLHL7 protein is attenuated by autosomal dominant retinitis pigmentosa causative mutation. J. Biol. Chem. (0021-9258) 2011 imex curation Kigoshi Y., Tsuruta F., Chiba T. tchiba@biol.tsukuba.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Kigoshi Y., Tsuruta F., Chiba T. tchiba@biol.tsukuba.ac.jp Accepted 2015-JAN-20 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Ubiquitin ligase activity of Cul3-KLHL7 protein is attenuated by autosomal dominant retinitis pigmentosa causative mutation. Ubiquitin ligase activity of Cul3-KLHL7 protein is attenuated by autosomal dominant retinitis pigmentosa causative mutation. J. Biol. Chem. (0021-9258) 2011 imex curation Kigoshi Y., Tsuruta F., Chiba T. tchiba@biol.tsukuba.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kigoshi Y., Tsuruta F., Chiba T. tchiba@biol.tsukuba.ac.jp Accepted 2015-JAN-20 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Ubiquitin ligase activity of Cul3-KLHL7 protein is attenuated by autosomal dominant retinitis pigmentosa causative mutation. Ubiquitin ligase activity of Cul3-KLHL7 protein is attenuated by autosomal dominant retinitis pigmentosa causative mutation. J. Biol. Chem. (0021-9258) 2011 imex curation Kigoshi Y., Tsuruta F., Chiba T. tchiba@biol.tsukuba.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kigoshi Y., Tsuruta F., Chiba T. tchiba@biol.tsukuba.ac.jp Accepted 2015-JAN-20 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH DIP protein P62877 original sequence version: 120 DIP protein P62877 original sequence version: 115 DIP protein P62877 original sequence version: 78 DIP protein P62877 original sequence version: 113 DIP protein P62877 original sequence version: 75 DIP protein P62877 original sequence version: 86 DIP protein P62877 original sequence version: 136 DIP protein P62877 original sequence version: 126 DIP protein P62877 original sequence version: 90 DIP protein P62877 original sequence version: 114 30FC5ADF66096C0E klhl7_human Kelch-like protein 7 KLHL7 protein protein human Homo sapiens Human MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRVVLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLNQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKTVQAEPLIQDNPECLKMVISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANEETLET FA4ED8F1567AC7A8 cul3_human Cullin-3 CUL3 KIAA0617 protein protein human Homo sapiens Human MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA DIP protein Q13618 original sequence version: 140 DIP protein Q13618 original sequence version: 163 DIP protein Q13618 original sequence version: 121 DIP protein Q13618 original sequence version: 161 A1A02022480BF099 klhl7-cul3 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1A klhl7-cul3-6 3 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection btb_domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain back_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined back-btb_poz sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8IXQ5:p.Ala153Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A T variant in Retinitis pigmentosa 42 (RP42) [MIM:612943]; UniProt FTId=:VAR_060673 Wed May 02 15:55:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153thr' Tue Jun 30 17:18:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Thr' Q8IXQ5:p.Ala153Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A V variant in Retinitis pigmentosa 42 (RP42) [MIM:612943]; UniProt FTId=:VAR_060674 Wed May 02 15:16:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 18:23:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' 6 unspecified role unspecified role prey prey physical association physical association 1C and 5A, supplemental 5B cul3-klhl7 1 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8IXQ5:p.Ala153Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A V variant in Retinitis pigmentosa 42 (RP42) [MIM:612943]; UniProt FTId=:VAR_060674 Wed May 02 14:25:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 16:37:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' colocalization colocalization 1D and 5B klhl7-klhl7-5 2 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined btb_poz sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1E and 5C klhl7-klhl7-2 1 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Q8IXQ5:p.Ala153Val mutation mutation certain certain sequence position certain certain certain sequence position certain A V variant in Retinitis pigmentosa 42 (RP42) [MIM:612943]; UniProt FTId=:VAR_060674 Wed May 02 18:59:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 18:09:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5D klhl7-cul3-3 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8IXQ5:p.Ala153Val mutation mutation certain certain sequence position certain certain certain sequence position certain A V Wed May 02 14:48:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 18:00:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' association association 6A klhl7-cul3-4 3 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q8IXQ5:p.Ala153Val mutation mutation certain certain sequence position certain certain certain sequence position certain A V Wed May 02 15:47:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 17:05:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association 6A cul3-klhl7-1 1 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Q8IXQ5:p.Ser150Asn mutation mutation certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:46:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser150asn' Tue Jun 30 16:58:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser150Asn' Q8IXQ5:p.Ala153Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A V variant in Retinitis pigmentosa 42 (RP42) [MIM:612943]; UniProt FTId=:VAR_060674 Wed May 02 17:26:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 20:17:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization supplemental 4 klhl7-klhl7-3 2 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8IXQ5:p.Ser150Asn mutation mutation certain certain sequence position certain certain certain sequence position certain S N Wed May 02 20:06:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser150asn' Tue Jun 30 19:45:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser150Asn' Q8IXQ5:p.Ala153Val mutation mutation certain certain sequence position certain certain certain sequence position certain A V Wed May 02 19:23:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 17:47:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' physical association physical association supplemental 5A klhl7-cul3-5 2 6 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey cell lysate cell lysate 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q8IXQ5:p.Ala153Val mutation mutation certain certain sequence position certain certain certain sequence position certain A V Wed May 02 15:25:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 18:35:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association supplemental 5B klhl7-klhl7-4 2 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection Q8IXQ5:p.Ala153Val mutation mutation certain certain sequence position certain certain certain sequence position certain A V Wed May 02 14:52:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 17:01:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true Q8IXQ5:p.Ala153Val mutation mutation certain certain sequence position certain certain certain sequence position certain A V Wed May 02 16:42:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala153val' Tue Jun 30 16:28:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala153Val' physical association physical association 5C