IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. hove@bio.ku.dk Only protein-protein interactions ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column sequence tag sequence tag identification sequence tag Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. Fractions from the gel filtration columns were either run on an SDS-PAGE (Fig.s 2b & 2c) or a native gel (Fig. 2e & 4d) prior to MS/MS analysis. hove@bio.ku.dk Accepted 2015-MAY-26 by MGT Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. hove@bio.ku.dk Only protein-protein interactions ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. hove@bio.ku.dk Accepted 2015-MAY-26 by MGT Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. hove@bio.ku.dk Only protein-protein interactions ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. The cross-linking agent was glutaraldehyde. Proteins were purified on a Ni-column. Figures 2f & 4c were not curated as the crosslinked complexes are not clearly identified. hove@bio.ku.dk Accepted 2015-MAY-26 by MGT Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Five phosphonate operon gene products as components of a multi-subunit complex of the carbon-phosphorus lyase pathway. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. hove@bio.ku.dk Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jochimsen B., Lolle S., McSorley FR., Nabi M., Stougaard J., Zechel DL., Hove-Jensen B. hove@bio.ku.dk Accepted 2015-MAY-26 by MGT Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation phnj_ecoli Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase phnJ b4098 JW4059 protein protein ecoli Escherichia coli (strain K12) MANLSGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPMPYGWGTGGIQLTASVIGESDVLKVIDQGADDTTNAVSIRNFFKRVTGVNTTERTDDATVIQTRHRIPETPLTEDQIIIFQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYEDIARFGHIATTYAYPVKVNGRYVMDPSPIPKFDNPKMDMMPALQLFGAGREKRIYAVPPFTRVESLDFDDHPFTVQQWDEPCAICGSTHSYLDEVVLDDAGNRMFVCSDTDYCRQQSEAKNQ DIP protein P16688 original sequence version: 102 DIP protein P16688 original sequence version: 105 241F6AF140995468 phni_ecoli Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI Ribose 1-methylphosphonate 5-triphosphate synthase nucleosidase subunit JW4060 b4099 phnI protein protein ecoli Escherichia coli (strain K12) MYVAVKGGEKAIDAAHALQESRRRGDTDLPELSVAQIEQQLNLAVDRVMTEGGIADRELAALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPLDTTGMRLERRISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGEAPTLTTADSEQQPSPHVFSLLARQGLAKFEEDSGAQPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRNHPFAGEIRSGYIDVSIVPEELGFAVNVGELLMTECEMVNGFIDPPGEPPHFTRGYGLVFGMSERKAMAMALVDRALQAPEYGEHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAELELLKRLQQEQNHG DIP protein P16687 original sequence version: 68 DIP protein P16687 original sequence version: 105 DIP protein P16687 original sequence version: 107 9E974F01B85CCE81 phng_ecoli Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG JW4062 b4101 phnG protein protein ecoli Escherichia coli (strain K12) MHADTATRQHWMSVLAHSQPAELAARLNALNITADYEVIRAAETGLVQIQARMGGTGERFFAGDATLTRAAVRLTDGTLGYSWVQGRDKQHAERCALIDALMQQSRHFQNLSETLIAPLDADRMARIAARQAEVNASRVDFFTMVRGDNA DIP protein P16685 original sequence version: 66 DIP protein P16685 original sequence version: 105 DIP protein P16685 original sequence version: 107 818A95526FAD0817 phnk_ecoli Putative phosphonates utilization ATP-binding protein PhnK JW5727 b4097 phnK protein protein ecoli Escherichia coli (strain K12) MNQPLLSVNNLTHLYAPGKGFSDVSFDLWPGEVLGIVGESGSGKTTLLKSISARLTPQQGEIHYENRSLYAMSEADRRRLLRTEWGVVHQHPLDGLRRQVSAGGNIGERLMATGARHYGDIRATAQKWLEEVEIPANRIDDLPTTFSGGMQQRLQIARNLVTHPKLVFMDEPTGGLDVSVQARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVMKQGQVVESGLTDRVLDDPHHPYTQLLVSSVLQN DIP protein P16678 original sequence version: 127 DIP protein P16678 original sequence version: 129 3B8677F22C472A9F phnh_ecoli Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH JW4061 b4100 phnH protein protein ecoli Escherichia coli (strain K12) MTLETAFMLPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDTPVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSTGTAVAPEAGATLILQVASLSGGRMLRLTGAGIAEERMIAPQLPECILHELTERPHPFPLGIDLILTCGERLLAIPRTTHVEVC DIP protein P16686 original sequence version: 108 DIP protein P16686 original sequence version: 110 69F068F78EF44EF3 phng-phnh-1 1 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Fig.s 2b, 2c, 2e (bands 1-4), 4d (lane 1) phng-phnh-2 2 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Fig.s 2d (lanes 1 & 2), 4b (lane 1) phnk-phng-1 4 8 unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey physical association physical association Fig.s 2d (lane 3) phng-phnh-4 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Fig.s 2e (band 5), 4c (lane 2, bands 1-3) phnh-1 3 9 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3 phnh-2 3 9 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3 phnh-3 3 9 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3 phng-phnh-3 2 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 4b (lane 3) phng-phni-1 2 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 4b (lane 2) phng-phnh-5 1 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig.4d (lane 3, band 5)