UniProt UniProt http://www.uniprot.org Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function. Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function. J. Biol. Chem. (0021-9258) 2011 imex curation Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M. Recombinant LRP4 ECD (as used in Elisa and surface plasmon resonance interaction assays) comprises extracellular aa21-1763 (39 exons) refers to ENSP0000025991; however this identifier can not be found in ENSEMBL. Instead UniProt LRP4 (which corresponds to the full length protein mentioned in the publication) has been used to map the extracellular domain (aa 21-1725). Expression system for recombinant SOST/sclerostin used in ELISA and SPR experiments is not specified in the publication, so it is not known if the his-tag (HBK11 cells ) is retained or not. olivier.leupin@novartis.com 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M. Recombinant LRP4 ECD (as used in Elisa and surface plasmon resonance interaction assays) comprises extracellular aa21-1763 (39 exons) refers to ENSP0000025991; however this identifier can not be found in ENSEMBL. Instead UniProt LRP4 (which corresponds to the full length protein mentioned in the publication) has been used to map the extracellular domain (aa 21-1725). Expression system for recombinant SOST/sclerostin used in ELISA and SPR experiments is not specified in the publication, so it is not known if the his-tag (HBK11 cells ) is retained or not. olivier.leupin@novartis.com Accepted 2015-JAN-23 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function. Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function. J. Biol. Chem. (0021-9258) 2011 imex curation Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M. Recombinant LRP4 ECD (as used in Elisa and surface plasmon resonance interaction assays) comprises extracellular aa21-1763 (39 exons) refers to ENSP0000025991; however this identifier can not be found in ENSEMBL. Instead UniProt LRP4 (which corresponds to the full length protein mentioned in the publication) has been used to map the extracellular domain (aa 21-1725). Expression system for recombinant SOST/sclerostin used in ELISA and SPR experiments is not specified in the publication, so it is not known if the his-tag (HBK11 cells ) is retained or not. olivier.leupin@novartis.com 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M. Recombinant LRP4 ECD (as used in Elisa and surface plasmon resonance interaction assays) comprises extracellular aa21-1763 (39 exons) refers to ENSP0000025991; however this identifier can not be found in ENSEMBL. Instead UniProt LRP4 (which corresponds to the full length protein mentioned in the publication) has been used to map the extracellular domain (aa 21-1725). Expression system for recombinant SOST/sclerostin used in ELISA and SPR experiments is not specified in the publication, so it is not known if the his-tag (HBK11 cells ) is retained or not. olivier.leupin@novartis.com Accepted 2015-JAN-23 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function. Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function. J. Biol. Chem. (0021-9258) 2011 imex curation Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M. Recombinant LRP4 ECD (as used in Elisa and surface plasmon resonance interaction assays) comprises extracellular aa21-1763 (39 exons) refers to ENSP0000025991; however this identifier can not be found in ENSEMBL. Instead UniProt LRP4 (which corresponds to the full length protein mentioned in the publication) has been used to map the extracellular domain (aa 21-1725). Expression system for recombinant SOST/sclerostin used in ELISA and SPR experiments is not specified in the publication, so it is not known if the his-tag (HBK11 cells ) is retained or not. olivier.leupin@novartis.com 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M. Recombinant LRP4 ECD (as used in Elisa and surface plasmon resonance interaction assays) comprises extracellular aa21-1763 (39 exons) refers to ENSP0000025991; however this identifier can not be found in ENSEMBL. Instead UniProt LRP4 (which corresponds to the full length protein mentioned in the publication) has been used to map the extracellular domain (aa 21-1725). Expression system for recombinant SOST/sclerostin used in ELISA and SPR experiments is not specified in the publication, so it is not known if the his-tag (HBK11 cells ) is retained or not. olivier.leupin@novartis.com Accepted 2015-JAN-23 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation sost_human Sclerostin SOST UNQ2976/PRO7455/PRO7476 protein protein human Homo sapiens Human MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY DIP protein Q9BQB4 original sequence version: 92 30DBD55CE73D5BB2 lrp5_human Low-density lipoprotein receptor-related protein 5 LRP5 LRP7 LR3 Low-density lipoprotein receptor-related protein 7 protein protein human Homo sapiens Human MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS DIP protein O75197 original sequence version: 94 DIP protein O75197 original sequence version: 108 8BA25D07F51E02CA lrp4_human Low-density lipoprotein receptor-related protein 4 LRP4 KIAA0816 MEGF7 Multiple epidermal growth factor-like domains 7 LRP10 protein protein human Homo sapiens Human MRRQWGALLLGALLCAHGLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCHSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCALDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQGCTNSEGAFQCWCETGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGGCSHLCLRSPNPSGFSCTCPTGINLLSDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRHTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVRSNLPGLMDMQAVDRAQPLGFNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASDFVCACPDEPDSRPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAPGEGLHISYAIGGLLSILLILVVIAALMLYRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV A39117C18279F9AA lrp6_human Low-density lipoprotein receptor-related protein 6 LRP6 protein protein human Homo sapiens Human MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS DIP protein O75581 original sequence version: 116 DIP protein O75581 original sequence version: 95 DIP protein O75581 original sequence version: 131 DIP protein O75581 original sequence version: 112 DIP protein O75581 original sequence version: 136 DIP protein O75581 original sequence version: 59 DIP protein O75581 original sequence version: 103 DIP protein O75581 original sequence version: 100 413D2CF70A5D8B5C sost-lrp4 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 1A, Table 1 sost-lrp4-1 3 4 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range O75096:p.Arg1170Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R W variant in Sclerosteosis 2 (SOST2) [MIM:614305]; UniProt FTId: VAR_066630 Wed May 02 14:39:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1170trp' Tue Jun 30 16:37:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1170Trp' igg1 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus cd33 signal fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range O75096:p.Trp1186Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W S Variant in Sclerosteosis 2 (SOST2) [MIM:614305]; UniProt FTId: VAR_066631 Wed May 02 16:29:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp1186ser' Tue Jun 30 19:39:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1186Ser' human-hkb11 Homo sapiens HKB-11 somatic cell hybridoma (fused human embryonic kidney cells (293S) and modified Burkitt's lymphoma cells (2B8) ) hkb11 HKB-11 somatic cell hybridoma (fused human embryonic kidney cells (293S) and modified Burkitt's lymphoma cells (2B8) ) direct interaction direct interaction 1B and C Association is blocked by incubation with SOST/sclerostin antibody sost-lrp4-2 2 6 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range true n-terminus cd33 signal fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range igg1 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hkb11 Homo sapiens HKB-11 somatic cell hybridoma (fused human embryonic kidney cells (293S) and modified Burkitt's lymphoma cells (2B8) ) hkb11 HKB-11 somatic cell hybridoma (fused human embryonic kidney cells (293S) and modified Burkitt's lymphoma cells (2B8) ) 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction 1D Association is blocked by incubation with SOST/sclerostin antibody sost-lrp4-3 3 6 unspecified role unspecified role prey prey O75096:p.Trp1186Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true W S Variant in Sclerosteosis 2 (SOST2) [MIM:614305]; UniProt FTId: VAR_066631. Wed May 02 19:14:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp1186ser' Tue Jun 30 17:29:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1186Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range true igg1 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true O75096:p.Arg1170Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true R W variant in Sclerosteosis 2 (SOST2) [MIM:614305]; UniProt FTId: VAR_066630 Wed May 02 18:09:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1170trp' Tue Jun 30 19:19:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1170Trp' n-terminus cd33 signal fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range true human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true physical association physical association 5 C and E Association is blocked by incubation with SOST/sclerostin antibody