IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The DEAD-box RNA helicase-like Utp25 is an SSU processome component. The DEAD-box RNA helicase-like Utp25 is an SSU processome component. RNA (New York, N.Y.) 2010 imex curation Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu Accepted 2015-JUL-29 by ORCHARD RNA (New York, N.Y.) 2010 imex curation OK. I have added only for the prey. Is it correct or I should add it also for the bait? The DEAD-box RNA helicase-like Utp25 is an SSU processome component. The DEAD-box RNA helicase-like Utp25 is an SSU processome component. RNA (New York, N.Y.) 2010 imex curation Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip northern blot northern blot northen Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu Accepted 2015-JUL-29 by ORCHARD RNA (New York, N.Y.) 2010 imex curation OK. I have added only for the prey. Is it correct or I should add it also for the bait? The DEAD-box RNA helicase-like Utp25 is an SSU processome component. The DEAD-box RNA helicase-like Utp25 is an SSU processome component. RNA (New York, N.Y.) 2010 imex curation Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu Accepted 2015-JUL-29 by ORCHARD RNA (New York, N.Y.) 2010 imex curation OK. I have added only for the prey. Is it correct or I should add it also for the bait? The DEAD-box RNA helicase-like Utp25 is an SSU processome component. The DEAD-box RNA helicase-like Utp25 is an SSU processome component. RNA (New York, N.Y.) 2010 imex curation Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Charette JM., Baserga SJ., Charette JM., Baserga SJ. susan.baserga@yale.edu Accepted 2015-JUL-29 by ORCHARD RNA (New York, N.Y.) 2010 imex curation OK. I have added only for the prey. Is it correct or I should add it also for the bait? utp8_yeast U3 small nucleolar RNA-associated protein 8 UTP8 t-UTP8 U three protein 8 U3 protein 8 required for transcription YGR128C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPTPKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 6F5AE1492F841F49 6F5AE1492F841F49 utp25_yeast U3 small nucleolar RNA-associated protein 25 YIL091C UTP25 U three protein 25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSSVREKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIEDEEGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIENGLLGNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 301BC87BCA027104 sas10_yeast Something about silencing protein 10 SAS10 UTP3 U3 small nucleolar RNA-associated protein 3 U3 snoRNA-associated protein 11 U three protein 3 YDL153C D1545 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVRKGSNRTKTSEVGDEINPYGLNEVDDFASKREKVLLGQSTFGDSNKDDDHSLLEDEDEEEVLAMDEDDESIDEREDEEEEEEEELDGAAAYKKIFGRNLETDQLPEEDEENGMLDNENAWGSTKGEYYGADDLDDDEAAKEIEKEALRQQKKHLEELNMNDYLDEEEEEEWVKSAKEFDMGEFKNSTKQADTKTSITDILNMDDEARDNYLRTMFPEFAPLSKEFTELAPKFDELKKSEENEFNKLKLIALGSYLGTISCYYSILLHELHNNEDFTSMKGHPVMEKILTTKEIWRQASELPSSFDVNEGDGSESEETANIEAFNEKKLNELQNSEDSDAEDGGKQKQEIDEEERESDEEEEEEDVDIDDFEEYVAQSRLHSKPKTSSMPEADDFIESEIADVDAQDKKARRRTLRFYTSKIDQQENKKTDRFKGDDDIPYKERLFERQQRLLDEARKRGMHDNNGADLDDKDYGSEDEAVSRSINTQGENDYYQQVQRGKQDKKISRKEAHKNAVIAAREGKLAELAENVSGDGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQKKLKSVRAVYSGGQSGVYEGEKTGIKKGLTRSVKFKN 9278BF873834FC7E 9278BF873834FC7E snru3a yeast small nuclear RNA U3a Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GUCGACGUACUUCAGUAUGUAAUAUACCCCAAACAUUUUACCCACAAAAAACCAGGAUUUGAAAACUAUAGCAUCUAAAAGUCUUAGGUACUAGAGUUUUCAUUUCGGAGCAGGCUUUUUGAAAAAUUUAAUUCAACCAUUGCAGCAGCUUUUGACUAACACAUUCUACAGUAGGAUCAUUUCUAUAGGAAUCGUCACUCUUUGACUCUUCAAAAGAGCCACUGAAUCCAACUUGGUUGAUGAGUCCCAUAACCUUUGUACCCCAGAGUGAGAAACCGAAAUUGAAUCUAAAUUAGCUUGGUCCGCAAUCCUUAGCGGUUCGGCCAUCUAUAAUUUUGAAUAAAAAUUUUGCUUUGCCGUUGCAUUUGUAGUUUUUUCCUUUGGAAGUAAUUACAAUAUUUUAUGGCGCGAUGAUCUUGACCCAUCCUAUGUACUUCUUUUUUGAAGGGAUAGGGCUCUAUGGGUGGGUACAAAUGGCAGUCUGACAAGU rrp9_yeast Ribosomal RNA-processing protein 9 RRP9 YPR137W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDVTQQKKRKRSKGEVNPSKPTVDEEITDPSSNEDEQLEVSDEEDALESEEEFEGENPADKRRRLAKQYLENLKSEANDILTDNRNAEEKDLNNLKERTIDEYNNFDAGDLDKDIIASRLKEDVAEQQGRVFRYFGDKLLISEAKQSFTRVGENNLTCISCFQPVLNKYTFEESSNGDKNKGRLFAYTVSKDLQLTKYDITDFSKRPKKLKYAKGGAKYIPTSKHEYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSDQLYASCADFKIRTYSINQFSQLEILYGHHDIVEDISALAMERCVTVGARDRTAMLWKIPDETRLTFRGGDEPQKLLRRWMKENAKEGEDGEVKYPDESEAPLFFCEGSIDVVSMVDDFHFITGSDNGNICLWSLAKKKPIFTERIAHGILPEPSFNDISGETDEELRKRQLQGKKLLQPFWITSLYAIPYSNVFISGSWSGSLKVWKISDNLRSFELLGELSGAKGVVTKIQVVESGKHGKEKFRILASIAKEHRLGRWIANVSGARNGIYSAVIDQTGF 96BEAB7DC338E70E 96BEAB7DC338E70E utp6_yeast U3 small nucleolar RNA-associated protein 6 U three protein 6 YDR449C D9461.34 UTP6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSINDYIKYINYESNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTNKFPQDLKFWAMYLNYMKARGNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPKLWYEYVKFELNFITKLINRRKVMGLINEREQELDMQNEQKNNQAPDEEKSHLQVPSTGDSMKDKLNELPEADISVLGNAETNPALRGDIALTIFDVCMKTLGKHYINKHKGYYAISDSKMNIELNKETLNYLFSESLRYIKLFDEFLDLERDYLINHVLQFWKNDMYDLSLRKDLPELYLKTVMIDITLNIRYMPVEKLDIDQLQLSVKKYFAYISKLDSASVKSLKNEYRSYLQDNYLKKMNAEDDPRYKILDLIISKL 60FD2E0E1B3B79B3 60FD2E0E1B3B79B3 mpp10_yeast U3 small nucleolar RNA-associated protein MPP10 MPP10 YJR002W J1411 YJR83.5 M phase phosphoprotein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELFGVLKSNAGRIILKDPSATSKDVKAYIDSVINTCKNGSITKKAELDEITVDGLDANQVWWQVKLVLDSIDGDLIQGIQELKDVVTPSHNLSDGSTLNSSSGEESELEEAESVFKEKQMLSADVSEIEEQSNDSLSENDEEPSMDDEKTSAEAAREEFAEEKRISSGQDERHSSPDPYGINDKFFDLEKFNRDTLAAEDSNEASEGSEDEDIDYFQDMPSDDEEEEAIYYEDFFDKPTKEPVKKHSDVKDPKEDEELDEEEHDSAMDKVKLDLFADEEDEPNAEGVGEASDKNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRTLLDITRKSQRPQFELSDVKSSKSLAEIYEDDYTRAEDESALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSKANLPNVNKRSKRNDVVDTLSKAKNITVINQKGEKKDVSGKTKKSRSGPDSTNIKL DEAF52FC003A0FFD DEAF52FC003A0FFD utp21_yeast U3 small nucleolar RNA-associated protein 21 YLR409C L8084.22 UTP21 U three protein 21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIDLKKRKVEEDVRSRGKNSKIFSPFRIIGNVSNGVPFATGTLGSTFYIVTCVGKTFQIYDANTLHLLFVSEKETPSSIVALSAHFHYVYAAYENKVGIYKRGIEEHLLELETDANVEHLCIFGDYLCASTDDNSIFIYKKSDPQDKYPSEFYTKLTVTEIQGGEIVSLQHLATYLNKLTVVTKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTVTGEVIMFNMRKGKRIRTIKIPQSRISSLSFRTDGSSHLSVGTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRGGHSQPPSYIAFADSQSHFMLSASKDRSLWSFSLRKDAQSQEMSQRLHKKQDGGRVGGSTIKSKFPEIVALAIENARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTTDDGFVKSVAMSQCGNFGFIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQFKTVSTRTIDESEFARMALPSTSVRGNDSMLSGALESNGGEDLNDIDFNTYTSLEQIDKELLTLSIGPRSKMNTLLHLDVIRKRSKPKEAPKKSEKLPFFLQLSGEKVGDEASVREGIAHETPEEIHRRDQEAQKKLDAEEQMNKFKVTGRLGFESHFTKQLREGSQSKDYSSLLATLINFSPAAVDLEIRSLNSFEPFDEIVWFIDALTQGLKSNKNFELYETFMSLLFKAHGDVIHANNKNQDIASALQNWEDVHKKEDRLDDLVKFCMGVAAFVTTA F1F856EF28369351 F1F856EF28369351 utp18_yeast U3 small nucleolar RNA-associated protein 18 YJL069C J1098 HRE594 UTP18 U three protein 18 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMATTAMNVSVPPPDEEEQLLAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEGSESDNSEEDEAQNGELDHVNNDQLFFVDDGGNEDSQDKNEDTMDVDDEDDSSSDDYSEDSEEAAWIDSDDEKIKVPILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDDESDSELDDEEDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKDANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTFYTSLSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKVAHLQNSQTNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFRTILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNRWLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDALRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY 0FEBD4540CF039DA 0FEBD4540CF039DA utp25-mpp10-3 2 8 unspecified role unspecified role prey prey 11 western blot western blot Immuno blot Immuno blot northern blot northern blot northen unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig4A,B utp6-mpp10-1 2 10 unspecified role unspecified role bait bait HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey 11 western blot western blot Immuno blot Immuno blot northern blot northern blot northen unspecified role unspecified role prey prey association association Fig4A,B utp21-mpp10-1 2 12 unspecified role unspecified role bait bait tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey 11 western blot western blot Immuno blot Immuno blot northern blot northern blot northen unspecified role unspecified role prey prey association association Fig4A,B utp25-1 4 11 polyclonal western polyclonal antibody western blot polyclonal western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role prey prey tag TAP tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey tag tap tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role bait bait tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig4C mpp10-sas10-1 1 7 unspecified role unspecified role prey prey region two hybrid activation domain gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait region 2 hybrid dna binding domain gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6 A,B sas10-mpp10-1 1 7 unspecified role unspecified role bait bait region two hybrid binding domain gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey region 2 hybrid dna ad gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6 A,B sas10-mpp10-2 1 7 unspecified role unspecified role bait bait region two hybrid binding domain gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6 A,B sas10-utp6-1 1 10 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region two hybrid binding domain gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6 A,B sas10-utp21-1 1 6 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region two hybrid binding domain gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6 A,B sas10-utp6-2 1 10 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6 A,B utp6-sas10-1 1 10 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6 A,B utp21-utp6-9 1 12 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 6A,B utp6-utp6-1 1 10 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A,B utp6-utp21-2 1 12 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 6A,B utp25-mpp10-6 1 6 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A,B utp25-sas10-3 1 7 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig6A,B Fig7 utp25-utp21-1 1 6 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A,B sas10-sas10-1 1 7 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A,B utp8-1 3 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role prey prey tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig 8