UniProt UniProt http://www.uniprot.org Endogenous HMGB1 regulates autophagy. Endogenous HMGB1 regulates autophagy. The Journal of cell biology 2010 imex curation Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. Origin of transfected HMGB1-GFP according Scaffidi et al 2002 (pmid 12110890) (following Hoppe et al 2006 (pmid 16962095)) tangd2@upmc.edu Only protein-protein interactions mouse-panc02 mouse pancreatic tumor cell line Panc02, non-metastatic Mouse panc02 pancreatic tumor cell line Panc02, non-metastatic anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. tangd2@upmc.edu Accepted 2015-APR-02 by ORCHARD The Journal of cell biology 2010 IMEx mimix curation Endogenous HMGB1 regulates autophagy. Endogenous HMGB1 regulates autophagy. The Journal of cell biology 2010 imex curation Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. Origin of transfected HMGB1-GFP according Scaffidi et al 2002 (pmid 12110890) (following Hoppe et al 2006 (pmid 16962095)) tangd2@upmc.edu Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. tangd2@upmc.edu Accepted 2015-APR-02 by ORCHARD The Journal of cell biology 2010 IMEx mimix curation Endogenous HMGB1 regulates autophagy. Endogenous HMGB1 regulates autophagy. The Journal of cell biology 2010 imex curation Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. Origin of transfected HMGB1-GFP according Scaffidi et al 2002 (pmid 12110890) (following Hoppe et al 2006 (pmid 16962095)) tangd2@upmc.edu Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. Origin of transfected HMGB1-GFP according Scaffidi et al 2002 (pmid 12110890) (following Hoppe et al 2006 (pmid 16962095)) tangd2@upmc.edu Accepted 2015-APR-02 by ORCHARD The Journal of cell biology 2010 IMEx imex curation Endogenous HMGB1 regulates autophagy. Endogenous HMGB1 regulates autophagy. The Journal of cell biology 2010 imex curation Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. Origin of transfected HMGB1-GFP according Scaffidi et al 2002 (pmid 12110890) (following Hoppe et al 2006 (pmid 16962095)) tangd2@upmc.edu Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. Hmgb1-deficient MEF cell line has been used tangd2@upmc.edu Accepted 2015-APR-02 by ORCHARD The Journal of cell biology 2010 IMEx mimix curation Endogenous HMGB1 regulates autophagy. Endogenous HMGB1 regulates autophagy. The Journal of cell biology 2010 imex curation Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. Origin of transfected HMGB1-GFP according Scaffidi et al 2002 (pmid 12110890) (following Hoppe et al 2006 (pmid 16962095)) tangd2@upmc.edu Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tang D., Kang R., Livesey KM., Cheh CW., Farkas A., Loughran P., Hoppe G., Bianchi ME., Tracey KJ., Zeh HJ., Lotze MT. tangd2@upmc.edu Accepted 2015-APR-02 by ORCHARD The Journal of cell biology 2010 IMEx mimix curation becn1_mouse Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Becn1 protein protein mouse Mus musculus Mouse MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein O88597 original sequence version: 116 DIP protein O88597 original sequence version: 93 14623BA002E1AAEE becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C hmgb1_rat High mobility group protein B1 Amphoterin Heparin-binding protein p30 High mobility group protein 1 Hmgb1 Hmg-1 Hmg1 protein protein rat Rattus norvegicus (Rat) Rat MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE 8A868DE266D552B5 hmgb1_human High mobility group protein B1 HMGB1 HMG1 High mobility group protein 1 protein protein human Homo sapiens Human MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE DIP protein P09429 original sequence version: 141 8A868CF277D417B5 hmgb1_mouse High mobility group protein B1 Hmgb1 Hmg-1 Hmg1 High mobility group protein 1 protein protein mouse Mus musculus Mouse MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE 8A868DE266D552B5 bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10417 original sequence version: 71 DIP protein P10417 original sequence version: 126 80FDCFE78C735092 becn1-hmgb1-1 5 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 4C hmgb1-becn1-1 5 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 4C becn1-hmgb1-2 1 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 4C HBSS (inducing starvation) hmgb1-becn1-2 1 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 4C HBSS (inducing starvation) becn1-hmgb1-3 2 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association 4B and 4D The association of Bcl-2 is lost upon HBSS (inducing starvation) treatment but not upon combined HBSS + U0126 (MEK/ERKK inhibitor) treatment. bcl2-becn1-9 2 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 4B and D The association of Beclin1 and HMGB1 is lost upon HBSS (inducing starvation). Combined HBSS + U0126 (MEK/ERKK inhibitor) treatment leads to loss of HMGB1 but not Beclin1. Treatment with Beclin1 RNAi leads to a loss of HMGB1. becn1-bcl2-3 4 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 4B and 5D The association of Bcl-2 is not lost upon HBSS (inducing starvation) or combined HBSS + U0126 (MEK/ERKK inhibitor) treatment. bcl2-becn1-10 4 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 4B becn1-hmgb1-4 3 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey P63159:p.Cys45Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:41:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys45ser' Tue Jun 30 16:09:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys45Ser' P63159:p.Cys23Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S Wed May 02 20:18:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys23ser' Tue Jun 30 17:18:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys23Ser' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined HMGB1 mutations cys23ser and cys45ser lead to association of Bcl-2 instead. HMGB1 mutation cys106ser did not change association with beclin1. physical association physical association 5D HBSS (inducing starvation). Under basal conditions HMGB1 is replaced by Bcl-2 (see EBI-10728709).