IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. The Journal of biological chemistry 2010 imex curation Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. density sedimentation cosedimentation through density gradient density sedimentation anti tag western anti tag western blot anti tag western Gahring LC., Rogers SW. Not stated weather WB detected protein or tag in 4a, but 4b and 4c are both anti-tag so assumed they all were. In Fig. 4d, complexes were first immunodepleted by anti-alpha4 before being separated on a sucrose gradiant, followed by anti-tag Western Blot. scott.rogers@hsc.utah.edu Accepted 2015-JUN-04 by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. The Journal of biological chemistry 2010 imex curation Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu Accepted 2015-JUN-04 by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. The Journal of biological chemistry 2010 imex curation Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page anti tag western anti tag western blot anti tag western Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu Accepted 2015-JUN-04 by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. Nicotinic receptor subunit alpha5 modifies assembly, up-regulation, and response to pro-inflammatory cytokines. The Journal of biological chemistry 2010 imex curation Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Gahring LC., Rogers SW. scott.rogers@hsc.utah.edu Accepted 2015-JUN-04 by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation acha5_rat Neuronal acetylcholine receptor subunit alpha-5 Chrna5 Acra5 protein protein rat Rattus norvegicus (Rat) Rat MVQLLAGRWRPTGARRGTRGGLPELSSAAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFLLVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK 7CEB24553936B2E7 achb4_rat Neuronal acetylcholine receptor subunit beta-4 Chrnb4 Acrb4 Neuronal acetylcholine receptor non-alpha-2 chain protein protein rat Rattus norvegicus (Rat) Rat MRGTPLLLVSLFSLLQDGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSLVRVPHPSQLHLATADTAATSALGPTSPSNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSSGRFREDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGLFLPPLFQIHAPSKDS 688F37AB80448F7F achb2_rat Neuronal acetylcholine receptor subunit beta-2 Chrnb2 Acrb2 Neuronal acetylcholine receptor non-alpha-1 chain protein protein rat Rattus norvegicus (Rat) Rat MAGHSNSMALFSFSLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGALFFREGPAADPCTCFVNPASVQGLAGAFRAEPTAAGPGRSVGPCSCGLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYTATTFLHPDHSAPSSK 54C007A48225931C acha4_rat Neuronal acetylcholine receptor subunit alpha-4 Chrna4 Acra4 protein protein rat Rattus norvegicus (Rat) Rat MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSPTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQEAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKEPSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAAC mint After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane 1DFFC9E1378E5417 chrnb2-chrna4-2 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig.s 2a (upper left gel), 5a (left gel) chrna5-chrna4-1 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 2a (lower gels) chrnb2-chrna4-9 4 8 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait physical association physical association Fig. 3a (left gel) chrnb4-chrna4-1 4 8 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 3a (right gel) chrna4-chrna5-1 1 8 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4a chrnb4-chrna4-2 3 8 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.s 4c, 5b (top right) chrna4-chrna5-2 3 8 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.s 4c, 5b (top right) chrnb4-1 3 6 unspecified role unspecified role unspecified role unspecified role ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.s 4c, 5b (top right) chrna4-chrna5-3 1 8 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4d chrnb4-chrna4-3 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig.s 2a (upper right gel), 5a (right gel) chrna4-chrna5-4 3 8 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component ha tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5b (top left) chrna4-chrna5-5 1 8 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component r3b tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5b (bottom panels)