UniProt UniProt http://www.uniprot.org CD150 regulates JNK1/2 activation in normal and Hodgkin's lymphoma B cells. CD150 regulates JNK1/2 activation in normal and Hodgkin's lymphoma B cells. Immunology and cell biology 2010 imex curation Yurchenko MY., Kovalevska LM., Shlapatska LM., Berdova GG., Clark EA., Sidorenko SP. Origin of CD150/SLAMF1 according to Pubmed 10229804 (cited in Ref. 54) svetasid@onconet.kiev.ua 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yurchenko MY., Kovalevska LM., Shlapatska LM., Berdova GG., Clark EA., Sidorenko SP. Origin of CD150/SLAMF1 according to Pubmed 10229804 (cited in Ref. 54) svetasid@onconet.kiev.ua Accepted 2016-JAN-29 AT 09:11 GMT AT 09:11 GMT by ORCHARD Immunology and cell biology 2010 imex curation CD150 regulates JNK1/2 activation in normal and Hodgkin's lymphoma B cells. CD150 regulates JNK1/2 activation in normal and Hodgkin's lymphoma B cells. Immunology and cell biology 2010 imex curation Yurchenko MY., Kovalevska LM., Shlapatska LM., Berdova GG., Clark EA., Sidorenko SP. Origin of CD150/SLAMF1 according to Pubmed 10229804 (cited in Ref. 54) svetasid@onconet.kiev.ua 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions human-mp-1 human B lymphoblastoid cell line MP-1 Human mp-1 B lymphoblastoid cell line MP-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yurchenko MY., Kovalevska LM., Shlapatska LM., Berdova GG., Clark EA., Sidorenko SP. Origin of CD150/SLAMF1 according to Pubmed 10229804 (cited in Ref. 54) svetasid@onconet.kiev.ua Accepted 2016-JAN-29 AT 09:11 GMT AT 09:11 GMT by ORCHARD Immunology and cell biology 2010 imex curation slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES DIP protein Q13291 original sequence version: 151 DIP protein Q13291 original sequence version: 110 DIP protein Q13291 original sequence version: 106 DIP protein Q13291 original sequence version: 112 BFB0F27EA31D8C04 m4k1_human Mitogen-activated protein kinase kinase kinase kinase 1 HPK1 MAP4K1 MAPK/ERK kinase kinase kinase 1 Hematopoietic progenitor kinase protein protein human Homo sapiens Human MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQLSPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRKGCALLVKLFNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTPHLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWLGEMSTEHRGPVQVTQVEEDMVMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHGVQVWALGSDQLLQELRDPTLTFRLLGSPRLECSGTISPHCNLLLPGSSNSPASASRVAGITGL DIP protein Q92918 original sequence version: 96 3C98CF01BE42E151 sh21a_human SH2 domain-containing protein 1A SH2D1A DSHP SAP Signaling lymphocytic activation molecule-associated protein T-cell signal transduction molecule SAP Duncan disease SH2-protein protein protein human Homo sapiens Human MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP mint Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the slam cytoplasmic region Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma 90234E7A6614EE3D slamf1-map4k1-1 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 5a slamf1-map4k1-2 1 5 unspecified role unspecified role prey prey human-mp-1 human B lymphoblastoid cell line MP-1 Human mp-1 B lymphoblastoid cell line MP-1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey human-mp-1 human B lymphoblastoid cell line MP-1 Human mp-1 B lymphoblastoid cell line MP-1 association association 5b slamf1-map4k1-3 1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey human-t5-1 human B lymphoblastoid cell line T5-1 Human t5-1 B lymphoblastoid cell line T5-1 physical association physical association 5b