IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mammalian ALKBH8 possesses tRNA methyltransferase activity required for the biogenesis of multiple wobble uridine modifications implicated in translational decoding. Mammalian ALKBH8 possesses tRNA methyltransferase activity required for the biogenesis of multiple wobble uridine modifications implicated in translational decoding. Molecular and cellular biology 2010 imex curation Songe-Møller L., van den Born E., Leihne V., Vågbø CB., Kristoffersen T., Krokan HE., Kirpekar F., Falnes PØ., Klungland A. pal.falnes@imbv.uio.no Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Songe-Møller L., van den Born E., Leihne V., Vågbø CB., Kristoffersen T., Krokan HE., Kirpekar F., Falnes PØ., Klungland A. pal.falnes@imbv.uio.no Accepted 2015-JUN-08 by MGT Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation Mammalian ALKBH8 possesses tRNA methyltransferase activity required for the biogenesis of multiple wobble uridine modifications implicated in translational decoding. Mammalian ALKBH8 possesses tRNA methyltransferase activity required for the biogenesis of multiple wobble uridine modifications implicated in translational decoding. Molecular and cellular biology 2010 imex curation Songe-Møller L., van den Born E., Leihne V., Vågbø CB., Kristoffersen T., Krokan HE., Kirpekar F., Falnes PØ., Klungland A. pal.falnes@imbv.uio.no Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Songe-Møller L., van den Born E., Leihne V., Vågbø CB., Kristoffersen T., Krokan HE., Kirpekar F., Falnes PØ., Klungland A. I realise there is no detail of the Hybigenics library but the HS in the clone name stands for Homo sapiens so I feel OK entering this interactions as its a screen. A commissioned (Hybrigenics, Paris, France) yeast two-hybrid screen used human ALKBH8 as bait. pal.falnes@imbv.uio.no Accepted 2015-JUN-08 by MGT Molecular and cellular biology 2010 Only protein-protein interactions imex curation imex curation alkb8_human Alkylated DNA repair protein alkB homolog 8 Probable alpha-ketoglutarate-dependent dioxygenase ABH8 S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8 tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8 ABH8 ALKBH8 protein protein human Homo sapiens Human MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTRHTPWPHIVEFLKALPSGSIVADIGCGNGKYLGINKELYMIGCDRSQNLVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAERRVAALQEIVRLLRPGGKALIYVWAMEQEYNKQKSKYLRGNRNSQGKKEEMNSDTSVQRSLVEQMRDMGSRDSASSVPRINDSQEGGCNSRQVSNSKLPVHVNRTSFYSQDVLVPWHLKGNPDKGKPVEPFGPIGSQDPSPVFHRYYHVFREGELEGACRTVSDVRILQSYYDQGNWCVILQKA 4BE595D6757C2A43 tr112_human Multifunctional methyltransferase subunit TRM112-like protein tRNA methyltransferase 112 homolog AD-001 HSPC152 HSPC170 TRMT112 protein protein human Homo sapiens Human MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES A943569364D4FFEA alkbh8-trmt112-1 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association no figure alkbh8-trmt112-2 1 3 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association Fig. 6A