HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. The Journal of biological chemistry 2009 imex curation Bernal-Bayard J., Ramos-Morales F. framos@us.es Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bernal-Bayard J., Ramos-Morales F. framos@us.es Accepted 2015-MAY-13 by MGT The Journal of biological chemistry 2009 imex curation Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. The Journal of biological chemistry 2009 imex curation Bernal-Bayard J., Ramos-Morales F. framos@us.es Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bernal-Bayard J., Ramos-Morales F. framos@us.es Accepted 2015-APR-21 by MGT Hela cDNA library The Journal of biological chemistry 2009 imex curation Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. The Journal of biological chemistry 2009 imex curation Bernal-Bayard J., Ramos-Morales F. framos@us.es Only protein-protein interactions imex curation salt1 Salmonella typhimurium (strain 14028s / SGSC 2262) pull down pull down anti tag western anti tag western blot anti tag western Bernal-Bayard J., Ramos-Morales F. framos@us.es Accepted 2015-MAY-13 by MGT The Journal of biological chemistry 2009 imex curation Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. The Journal of biological chemistry 2009 imex curation Bernal-Bayard J., Ramos-Morales F. framos@us.es Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bernal-Bayard J., Ramos-Morales F. framos@us.es Accepted 2015-APR-21 by MGT The Journal of biological chemistry 2009 imex curation Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. The Journal of biological chemistry 2009 imex curation Bernal-Bayard J., Ramos-Morales F. framos@us.es Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Bernal-Bayard J., Ramos-Morales F. framos@us.es Accepted 2015-MAY-13 by MGT The Journal of biological chemistry 2009 imex curation Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. Salmonella type III secretion effector SlrP is an E3 ubiquitin ligase for mammalian thioredoxin. The Journal of biological chemistry 2009 imex curation Bernal-Bayard J., Ramos-Morales F. framos@us.es Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bernal-Bayard J., Ramos-Morales F. framos@us.es Accepted 2015-MAY-13 by MGT The Journal of biological chemistry 2009 imex curation slrp_salt1 E3 ubiquitin-protein ligase SlrP Secreted effector protein SlrP STM14_928 slrP RING-type E3 ubiquitin transferase SlrP protein protein salt1 Salmonella typhimurium (strain 14028s / SGSC 2262) MFNITNIQSTARHQSISNEASTEVPLKEEIWNKISAFFSSEHQVEAQNCIAYLCHPPETASPEEIKSKFECLRMLAFPAYADNIQYSRGGADQYCILSENSQEILSIVFNTEGYTVEGGGKSVTYTRVTESEQASSASGSKDAVNYELIWSEWVKEAPAKEAANREEAVQRMRDCLKNNKTELRLKILGLTTIPAYIPEQITTLILDNNELKSLPENLQGNIKTLYANSNQLTSIPATLPDTIQEMELSINRITELPERLPSALQSLDLFHNKISCLPENLPEELRYLSVYDNSIRTLPAHLPSEITHLNVQSNSLTALPETLPPGLKTLEAGENALTSLPASLPPELQVLDVSKNQITVLPETLPPTITTLDVSRNALTNLPENLPAALQIMQASRNNLVRLPESLPHFRGEGPQPTRIIVEYNPFSERTIQNMQRLMSSVDYQGPRVLFAMGDFSIVRVTRPLHQAVQGWLTSLEEEDVNQWRAFEAEANAAAFSGFLDYLGDTQNTRHPDFKEQVSAWLMRLAEDSALRETVFIIAMNATISCEDRVTLAYHQMQEATLVHDAERGAFDSHLAELIMAGREIFRLEQIESLAREKVKRLFFIDEVEVFLGFQNQLRESLSLTTMTRDMRFYNVSGITESDLDEAEIRIKMAENRDFHKWFALWGPWHKVLERIAPEEWREMMAKRDECIETDEYQSRVNAELEDLRIADDSDAERTTEVQMDAERAIGIKIMEEINQTLFTEIMENILLKKEVSSLMSAYWR 8BEC9FB8CE5CD25D thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV DIP protein P10599 original sequence version: 174 DIP protein P10599 original sequence version: 133 DIP protein P10599 original sequence version: 181 DIP protein P10599-1 original sequence version: 180 256F4E3C8A187693 ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM DIP protein P62837 original sequence version: 81 DIP protein P62837-1 original sequence version: 134 DIP protein P62837 original sequence version: 95 DIP protein P62837 original sequence version: 139 DIP protein P62837 original sequence version: 37 DIP protein P62837 original sequence version: 115 DIP protein P62837 original sequence version: 58 DIP protein P62837 original sequence version: 74 DIP protein P62837 original sequence version: 103 DIP protein P62837 original sequence version: 101 C942BE7853CBC355 slrp-trx-1 2 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association no figure slrp-txn-1 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1 slrp-txn-2 3 7 unspecified role unspecified role prey prey N/A flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait N/A gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2A txn-slrp-2 4 7 unspecified role unspecified role bait bait N/A flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role prey prey N/A ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2B slrp-txn-3 5 7 enzyme enzyme unspecified role unspecified role N/A gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range N/A ubiquitinylated lysine ubiquitinylated lysine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm 9 unspecified role unspecified role ancillary ancillary enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 4C Trx is ubiquitinated in the presence of SlrP An E1 molecule was also present, but cannot be identified. txn-slrp-3 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1 txn-slrp-4 6 7 unspecified role unspecified role prey prey N/A flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range salt1 Salmonella typhimurium (strain 14028s / SGSC 2262) 8 unspecified role unspecified role bait bait N/A gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3 A/B treatment of GST-Trx bound to glutathione-agarose beads with H2O2 before the in vitro interaction assay reduced the Slrp-Trx interaction. Hydrogen Peroxide