HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. The Journal of general virology 2009 imex curation Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. venu.gopal@bbsrc.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. venu.gopal@bbsrc.ac.uk Accepted 2015-JUN-29 by MGT The Journal of general virology 2009 imex curation Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. The Journal of general virology 2009 imex curation Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. venu.gopal@bbsrc.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 confocal microscopy confocal microscopy immunostaining immunostaining Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. venu.gopal@bbsrc.ac.uk Accepted 2015-JUN-29 by MGT The Journal of general virology 2009 imex curation Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. The Journal of general virology 2009 imex curation Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. venu.gopal@bbsrc.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-mononuclear-cell chick-mononuclear-cell Chicken mononuclear cells tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. cells were derived from virus-induced lymphoma tissue. venu.gopal@bbsrc.ac.uk Accepted 2015-JUL-01 by MGT The Journal of general virology 2009 imex curation Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. Interaction of Marek's disease virus oncoprotein Meq with heat-shock protein 70 in lymphoid tumour cells. The Journal of general virology 2009 imex curation Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. venu.gopal@bbsrc.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-embryonic_fibroblast Chick embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Zhao Y., Kurian D., Xu H., Petherbridge L., Smith LP., Hunt L., Nair V. venu.gopal@bbsrc.ac.uk Accepted 2015-JUN-29 by MGT The Journal of general virology 2009 imex curation hsp70_chick Heat shock 70 kDa protein protein protein chick Gallus gallus (Chicken) Chicken MSGKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKYDDPTVQSDMKHWPFRVVNEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGKKVETAVITVPAYFNDSQRQATKDAGTITGLNVMRIINEPTAAAIAYGLDKKGTRAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNRFVEEFKGKHKRDNAGNKRAVRRLRTACERARRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAEDEANRDRVGAKNSLESYTYNMKQTVEDEKLKGKISDQDKQKVLDKCQEVISSLDRNQMAEKEEYEHKQKELEKLCNPIVTKLYQGAGGAGAGGSGGPTIEEVD 4270F7F08D365AEB meq_gahvm Oncoprotein MEQ MDV005 MDV076 protein protein gahvm Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GaHV-2 Marek's disease herpesvirus type 1 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPAPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQVPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYTQFPSDTQSTVWWFPGDGRP meq-hsp70-1 4 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 1E hsp70_chick-meq_gahvm-1 2 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 1F hsp70_chick-meq_gahvm-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2A hsp70_chick-meq_gahvm-3 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2B meq_gahvm-hsp70_chick-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait N/A flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range N/A zz tag zz tag ZZ tag ZZ tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3