IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A direct interaction between the Utp6 half-a-tetratricopeptide repeat domain and a specific peptide in Utp21 is essential for efficient pre-rRNA processing. A direct interaction between the Utp6 half-a-tetratricopeptide repeat domain and a specific peptide in Utp21 is essential for efficient pre-rRNA processing. Molecular and cellular biology 2008 imex curation Champion EA., Lane BH., Jackrel ME., Regan L., Baserga SJ. susan.baserga@yale.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Champion EA., Lane BH., Jackrel ME., Regan L., Baserga SJ. susan.baserga@yale.edu susan.baserga @yale.edu Accepted 2015-JUL-15 by ORCHARD Molecular and cellular biology 2008 imex curation A direct interaction between the Utp6 half-a-tetratricopeptide repeat domain and a specific peptide in Utp21 is essential for efficient pre-rRNA processing. A direct interaction between the Utp6 half-a-tetratricopeptide repeat domain and a specific peptide in Utp21 is essential for efficient pre-rRNA processing. Molecular and cellular biology 2008 imex curation Champion EA., Lane BH., Jackrel ME., Regan L., Baserga SJ. susan.baserga@yale.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Champion EA., Lane BH., Jackrel ME., Regan L., Baserga SJ. susan.baserga@yale.edu susan.baserga @yale.edu Accepted 2015-JUL-21 by ORCHARD Molecular and cellular biology 2008 imex curation A direct interaction between the Utp6 half-a-tetratricopeptide repeat domain and a specific peptide in Utp21 is essential for efficient pre-rRNA processing. A direct interaction between the Utp6 half-a-tetratricopeptide repeat domain and a specific peptide in Utp21 is essential for efficient pre-rRNA processing. Molecular and cellular biology 2008 imex curation Champion EA., Lane BH., Jackrel ME., Regan L., Baserga SJ. susan.baserga@yale.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Champion EA., Lane BH., Jackrel ME., Regan L., Baserga SJ. susan.baserga@yale.edu susan.baserga @yale.edu Accepted 2015-JUL-21 by ORCHARD Molecular and cellular biology 2008 imex curation utp18_yeast U3 small nucleolar RNA-associated protein 18 YJL069C J1098 HRE594 UTP18 U three protein 18 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMATTAMNVSVPPPDEEEQLLAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEGSESDNSEEDEAQNGELDHVNNDQLFFVDDGGNEDSQDKNEDTMDVDDEDDSSSDDYSEDSEEAAWIDSDDEKIKVPILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDDESDSELDDEEDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKDANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTFYTSLSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKVAHLQNSQTNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFRTILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNRWLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDALRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY 0FEBD4540CF039DA 0FEBD4540CF039DA utp12_yeast U3 small nucleolar RNA-associated protein 12 DIP2 YLR129W L9233.1 L3116 UTP12 U three protein 12 DOM34-interacting protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGGKLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKREKRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKKLGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVMQNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGFNVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI 7D9AEC7AF6A9C740 7D9AEC7AF6A9C740 pwp2_yeast Periodic tryptophan protein 2 PWP2 UTP1 YCR057C YCR55C/YCR57C/YCR58C U3 small nucleolar RNA-associated protein 1 U three protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSDFKFSNLLGTVYRQGNITFSDDGKQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASGRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFFTTIHYSFDGMAIVAGGNNNSICLYDVPNEVLLKRFIVSRNMALNGTLEFLNSKKMTEAGSLDLIDDAGENSDLEDRIDNSLPGSQRGGDLSTRKMRPEVRVTSVQFSPTANAFAAASTEGLLIYSTNDTILFDPFDLDVDVTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEIPLVASNIPAIYLPRILKFIGDFAIESQHIEFNLIWIKALLSASGGYINEHKYLFSTAMRSIQRFIVRVAKEVVNTTTDNKYTYRFLVSTDGSMEDGAADDDEVLLKDDADEDNEENEENDVVMESDDEEGWIGFNGKDNKLPLSNENDSSDEEENEKELP CBEE4720F81378B6 CBEE4720F81378B6 utp21_yeast U3 small nucleolar RNA-associated protein 21 YLR409C L8084.22 UTP21 U three protein 21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIDLKKRKVEEDVRSRGKNSKIFSPFRIIGNVSNGVPFATGTLGSTFYIVTCVGKTFQIYDANTLHLLFVSEKETPSSIVALSAHFHYVYAAYENKVGIYKRGIEEHLLELETDANVEHLCIFGDYLCASTDDNSIFIYKKSDPQDKYPSEFYTKLTVTEIQGGEIVSLQHLATYLNKLTVVTKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTVTGEVIMFNMRKGKRIRTIKIPQSRISSLSFRTDGSSHLSVGTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRGGHSQPPSYIAFADSQSHFMLSASKDRSLWSFSLRKDAQSQEMSQRLHKKQDGGRVGGSTIKSKFPEIVALAIENARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTTDDGFVKSVAMSQCGNFGFIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQFKTVSTRTIDESEFARMALPSTSVRGNDSMLSGALESNGGEDLNDIDFNTYTSLEQIDKELLTLSIGPRSKMNTLLHLDVIRKRSKPKEAPKKSEKLPFFLQLSGEKVGDEASVREGIAHETPEEIHRRDQEAQKKLDAEEQMNKFKVTGRLGFESHFTKQLREGSQSKDYSSLLATLINFSPAAVDLEIRSLNSFEPFDEIVWFIDALTQGLKSNKNFELYETFMSLLFKAHGDVIHANNKNQDIASALQNWEDVHKKEDRLDDLVKFCMGVAAFVTTA F1F856EF28369351 F1F856EF28369351 utp6_yeast U3 small nucleolar RNA-associated protein 6 U three protein 6 YDR449C D9461.34 UTP6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSINDYIKYINYESNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTNKFPQDLKFWAMYLNYMKARGNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPKLWYEYVKFELNFITKLINRRKVMGLINEREQELDMQNEQKNNQAPDEEKSHLQVPSTGDSMKDKLNELPEADISVLGNAETNPALRGDIALTIFDVCMKTLGKHYINKHKGYYAISDSKMNIELNKETLNYLFSESLRYIKLFDEFLDLERDYLINHVLQFWKNDMYDLSLRKDLPELYLKTVMIDITLNIRYMPVEKLDIDQLQLSVKKYFAYISKLDSASVKSLKNEYRSYLQDNYLKKMNAEDDPRYKILDLIISKL 60FD2E0E1B3B79B3 60FD2E0E1B3B79B3 utp13_yeast U3 small nucleolar RNA-associated protein 13 UTP13 U three protein 13 YLR222C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLKTSYKGISLNPIYAGSSAVATVSENGKILATPVLDEINIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVNQQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLKRTNKPIEELFIIGVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELNKLALATNSPSLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAKLQVEQEQSLQNYMSKGDWTNAFLLAMTLDHPMRLFNVLKRALGESRSRQDTEEGKIEVIFNEELDQAISILNDEQLILLMKRCRDWNTNAKTHTIAQRTIRCILMHHNIAKLSEIPGMVKIVDAIIPYTQRHFTRVDNLVEQSYILDYALVEMDKLF A3DEA4288917027D A3DEA4288917027D mpp10_yeast U3 small nucleolar RNA-associated protein MPP10 MPP10 YJR002W J1411 YJR83.5 M phase phosphoprotein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELFGVLKSNAGRIILKDPSATSKDVKAYIDSVINTCKNGSITKKAELDEITVDGLDANQVWWQVKLVLDSIDGDLIQGIQELKDVVTPSHNLSDGSTLNSSSGEESELEEAESVFKEKQMLSADVSEIEEQSNDSLSENDEEPSMDDEKTSAEAAREEFAEEKRISSGQDERHSSPDPYGINDKFFDLEKFNRDTLAAEDSNEASEGSEDEDIDYFQDMPSDDEEEEAIYYEDFFDKPTKEPVKKHSDVKDPKEDEELDEEEHDSAMDKVKLDLFADEEDEPNAEGVGEASDKNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRTLLDITRKSQRPQFELSDVKSSKSLAEIYEDDYTRAEDESALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSKANLPNVNKRSKRNDVVDTLSKAKNITVINQKGEKKDVSGKTKKSRSGPDSTNIKL DEAF52FC003A0FFD DEAF52FC003A0FFD pwp2-utp18-2 2 6 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A utp6-utp21-1 2 7 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region DBD tag gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig7B pwp2-utp18-1 2 4 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A utp13-dip2-15 2 5 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A utp6-utp18-2 2 4 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait region DBD tag gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig6A utp6-mpp10-2 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q02354:p.Gly99Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G E Wed May 02 18:30:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly99glu' Tue Jun 30 18:18:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly99Glu' physical association physical association Fig5 utp6-3 3 7 unspecified role unspecified role bait bait tag biotin GGG biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role prey prey tag 6x his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range tag MBP tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q02354:p.Gly99Glu point mutation G99E mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G E Wed May 02 16:42:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly99glu' Tue Jun 30 16:39:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly99Glu' yeast Saccharomyces cerevisiae Baker's yeast direct interaction direct interaction Fig7D,E pwp2-utp18-3 2 6 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A dip2-utp13-1 2 5 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey tag gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A dip2-utp13-2 2 5 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A utp21-pwp2-17 2 6 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A utp21-pwp2-18 2 8 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig6A utp6_utp6-1 2 8 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig6A utp6-utp21-3 2 7 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait region DBD tag gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q02354:p.Gly99Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G E Wed May 02 17:12:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly99glu' Tue Jun 30 20:14:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly99Glu' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig6A, B, C