UniProt UniProt http://www.uniprot.org A new type of plasma prekallikrein deficiency associated with homozygosity for Gly104Arg and Asn124Ser in apple domain 2 of the heavy-chain region. A new type of plasma prekallikrein deficiency associated with homozygosity for Gly104Arg and Asn124Ser in apple domain 2 of the heavy-chain region. Eur. J. Haematol. (0902-4441) 2007 imex curation Katsuda I., Maruyama F., Ezaki K., Sawamura T., Ichihara Y. Coordinates of KLKB1/Plasma kallikrein heavy chain sites/regions adopted to UniProt (numbering including signal peptide) ikatsuda@fujita-hu.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Katsuda I., Maruyama F., Ezaki K., Sawamura T., Ichihara Y. Coordinates of KLKB1/Plasma kallikrein heavy chain sites/regions adopted to UniProt (numbering including signal peptide) ikatsuda@fujita-hu.ac.jp Accepted 2015-FEB-03 by ORCHARD Eur. J. Haematol. (0902-4441) 2007 imex curation p03952-pro_0000028021 Plasma kallikrein heavy chain KLKB1 KLK3 Fletcher factor Kininogenin Plasma prekallikrein protein protein human Homo sapiens Human GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR 20 390 52D301247F5C29CE kng1_human Kininogen-1 KNG1 BDK KNG Alpha-2-thiol proteinase inhibitor Fitzgerald factor High molecular weight kininogen Williams-Fitzgerald-Flaujeac factor protein protein human Homo sapiens Human MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS 3132B4DF2954C24E kng1-klkb1-2 1 3 unspecified role unspecified role bait bait purified purified 2 unspecified role unspecified role prey prey purified purified n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range apple_2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P03952-PRO_0000028021:p.Asn124Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain N S variant in n PKK deficiency [MIM: 612423]; dbSNP:rs3733402; UniProt FTId:VAR_013598 Wed May 02 15:35:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn124ser' Tue Jun 30 15:53:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn124Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4