UniProt UniProt http://www.uniprot.org Transcription factor SIX5 is mutated in patients with branchio-oto-renal syndrome. Transcription factor SIX5 is mutated in patients with branchio-oto-renal syndrome. American journal of human genetics 2007 imex curation Hoskins BE., Cramer CH., Silvius D., Zou D., Raymond RM., Orten DJ., Kimberling WJ., Smith RJ., Weil D., Petit C., Otto EA., Xu PX., Hildebrandt F. Origin of Eya1 construct according Pubmed 5141091 (same group used Eya1 in Y2H experiment) fhilde@umich.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hoskins BE., Cramer CH., Silvius D., Zou D., Raymond RM., Orten DJ., Kimberling WJ., Smith RJ., Weil D., Petit C., Otto EA., Xu PX., Hildebrandt F. Origin of Eya1 construct according Pubmed 5141091 (same group used Eya1 in Y2H experiment) fhilde@umich.edu Accepted 2015-DEC-14 AT 09:56 GMT AT 09:56 GMT by ORCHARD American journal of human genetics 2007 imex curation six5_human Homeobox protein SIX5 SIX5 DMAHP DM locus-associated homeodomain protein Sine oculis homeobox homolog 5 protein protein human Homo sapiens Human MATLPAEPSAGPAAGGEAVAAAAATEEEEEEARQLLQTLQAAEGEAAAAAGAGAGAAAAGAEGPGSPGVPGSPPEAASEPPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVLRARALVAFQRGEYAELYRLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYRLRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSNWFKNRRQRDRTGAGGGAPCKSESDGNPTTEDESSRSPEDLERGAAPVSAEAAAQGSIFLAGTGPPAPCPASSSILVNGSFLAASGSPAVLLNGGPVIINGLALGEASSLGPLLLTGGGGAPPPQPSPQGASETKTSLVLDPQTGEVRLEEAQSEAPETKGAQVAAPGPALGEEVLGPLAQVVPGPPTAATFPLPPGPVPAVAAPQVVPLSPPPGYPTGLSPTSPLLNLPQVVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVALQQGKIILTATFPTSMLVSQVLPPAPGLALPLKPETAISVPEGGLPVAPSPALPEAHALGTLSAQQPPPAAATTSSTSLPFSPDSPGLLPNFPAPPPEGLMLSPAAVPVWSAGLELSAGTEGLLEAEKGLGTQAPHTVLRLPDPDPEGLLLGATAGGEVDEGLEAEAKVLTQLQSVPVEEPLEL D8A2E8DBBBA263A2 eya1_mouse Eyes absent homolog 1 Eya1 protein protein mouse Mus musculus Mouse MEMQDLTSPHSRLSGSSESPSGPKLDSSHINSTSMTPNGTEVKTEPMSSSEIASTAADGSLDSFSGSALGSSSFSPRPAHPFSPPQIYPSKSYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTESGLSQSQSPGQTGFLSYGTSFGTPQPGQAPYSYQMQGSSFTTSSGLYSGNNSLTNSSGFNSSQQDYPSYPGFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGVTSQAVTDPTAEYSTIHSPSTPIKETDSERLRRGSDGKSRGRGRRNNNPSPPPDSDLERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSANLCLATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRVSSHSDLMALHHALELEYL D31F71852FBDC76C eya1-six5-1 1 3 unspecified role unspecified role prey prey eya_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role bait bait Q8N196:p.Ala158Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A T Variant linked to Branchiootorenal syndrome 2 (BOR2) (OMIM: 610896). UniProt FTId: VAR_032941 Wed May 02 17:31:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala158thr' Tue Jun 30 17:01:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala158Thr' Q8N196:p.Thr552Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T M Variant linked to Branchiootorenal syndrome 2 (BOR2) (OMIM: 610896). dbSNP:rs80356464. UniProt FTId: VAR_032944 Wed May 02 15:58:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr552met' Tue Jun 30 19:00:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr552Met' physical association physical association 2