UniProt UniProt http://www.uniprot.org Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu Accepted 2015-FEB-13 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu Accepted 2015-FEB-13 by ORCHARD human brain cDNA Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro ubiquitinase assay ubiquitinase assay ubiquitinase assay western blot western blot Immuno blot Immuno blot Gentry M.S., Worby C.A., Dixon J.E. Biotin-labeled ubiquitin has been used and monitored by western blot. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu Accepted 2015-FEB-13 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu Accepted 2015-FEB-13 by ORCHARD human brain cDNA Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Insights into Lafora disease: malin is an E3 ubiquitin ligase that ubiquitinates and promotes the degradation of laforin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gentry M.S., Worby C.A., Dixon J.E. In vitro ubiquitiantion assays and type of used E1 enzyme according pubmed 12654245 (ref 38). In vivo ubiquitination assay (fig 4) omitted. jedixon@ucsd.edu Accepted 2015-FEB-13 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 imex curation nhlc1_human E3 ubiquitin-protein ligase NHLRC1 NHLRC1 EPM2B Malin NHL repeat-containing protein 1 RING-type E3 ubiquitin transferase NHLRC1 protein protein human Homo sapiens Human MAAEASESGPALHELMREAEISLLECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLHLIELLGSALRQSPAAHRAAPSAPGALTCHHTFGGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLEHPLALGTGVCSTRVKVFSSSMQLVGQVDTFGLSLYFPSKITASAVTFDHQGNVIVADTSGPAILCLGKPEEFPVPKPMVTHGLSHPVALTFTKENSLLVLDTASHSIKVYKVDWG 3E8339D00165FBED uba1_human Ubiquitin-like modifier-activating enzyme 1 Ubiquitin-activating enzyme E1 Protein A1S9 UBA1 A1S9T UBE1 protein protein human Homo sapiens Human MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR DIP protein P22314 original sequence version: 157 DIP protein P22314 original sequence version: 152 4B413AAA75FAA562 ube2h_human Ubiquitin-conjugating enzyme E2 H UBE2H Ubiquitin-protein ligase H Ubiquitin carrier protein H UbcH2 Ubiquitin-conjugating enzyme E2-20K (E3-independent) E2 ubiquitin-conjugating enzyme H E2 ubiquitin-conjugating enzyme H protein protein human Homo sapiens Human MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL 3DD5D365945F708C ub2d1_human Ubiquitin-conjugating enzyme E2 D1 Ubiquitin-protein ligase D1 Ubiquitin carrier protein D1 UbcH5 Ubiquitin-conjugating enzyme E2-17 kDa 1 Ubiquitin-conjugating enzyme E2(17)KB 1 UBC4/5 homolog Stimulator of Fe transport UBE2D1 UBCH5 UBCH5A SFT UBC5A (E3-independent) E2 ubiquitin-conjugating enzyme D1 E2 ubiquitin-conjugating enzyme D1 protein protein human Homo sapiens Human MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM DIP protein P51668 original sequence version: 143 DIP protein P51668 original sequence version: 119 DIP protein P51668 original sequence version: 107 2E96FD0179EE119D epm2a_human Laforin EPM2A Lafora PTPase Glycogen phosphatase Glucan phosphatase protein protein human Homo sapiens Human MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLWLGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKRPAVYIDEEALARAQEDFFQKFGKVRSSVCSL DD79F917262AB458 ub2e1_human Ubiquitin-conjugating enzyme E2 E1 UBE2E1 UBCH6 Ubiquitin-protein ligase E1 Ubiquitin carrier protein E1 UbcH6 (E3-independent) E2 ubiquitin-conjugating enzyme E1 E2 ubiquitin-conjugating enzyme E1 protein protein human Homo sapiens Human MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT 2FBC50BE2A6A0008 ub2d3_human Ubiquitin-conjugating enzyme E2 D3 UBC5C Ubiquitin-protein ligase D3 Ubiquitin carrier protein D3 Ubiquitin-conjugating enzyme E2-17 kDa 3 Ubiquitin-conjugating enzyme E2(17)KB 3 UBE2D3 UBCH5C (E3-independent) E2 ubiquitin-conjugating enzyme D3 E2 ubiquitin-conjugating enzyme D3 protein protein human Homo sapiens Human MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM ADD74A8A708EFEE3 nhlrc1-uba1-3 3 6 enzyme enzyme neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 ancillary ancillary neutral component neutral component 8 enzyme target enzyme target substrate substrate neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 The authors state that the respective GST-tagged E2 enzyme islargely the ubiquitinated substrate (data not shown). nhlrc1-uba1-5 3 6 enzyme enzyme neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 ancillary ancillary neutral component neutral component physical association physical association 2 and 6 The authors state that the respective GST-tagged E2 enzyme islargely the ubiquitinated substrate (data not shown). nhlrc1-uba1-7 3 6 enzyme enzyme neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 12 enzyme target enzyme target substrate substrate neutral component neutral component 7 ancillary ancillary neutral component neutral component physical association physical association 2 The authors state that the respective GST-tagged E2 enzyme is largely the ubiquitinated substrate (data not shown). nhlrc1-uba1-9 3 6 enzyme enzyme neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate neutral component neutral component 7 ancillary ancillary neutral component neutral component physical association physical association 2 The authors state that the respective GST-tagged E2 enzyme islargely the ubiquitinated substrate (data not shown). nhlrc1-epm2a-1 4 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association no figure nhlrc1-epm2a-2 2 6 unspecified role unspecified role bait bait nhl repeat, subgroup sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q6VVB1:p.Glu280Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:17:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu280lys' Tue Jun 30 18:25:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu280Lys' Q6VVB1:p.Gln302Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Q P Variant in EPM2 (Epilepsy, progressive myoclonic 2; MIM:254780); UniProtFTId: VAR_019488 Wed May 02 14:55:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln302pro' Tue Jun 30 17:30:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln302Pro' 10 unspecified role unspecified role prey prey physical association physical association 3A and B epm2a-nhlrc1-16 1 6 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 10 unspecified role unspecified role bait bait purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 3C nhlrc1-epm2a-3 5 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q6VVB1:p.Cys26Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:50:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys26ser' Tue Jun 30 19:04:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys26Ser' Q6VVB1:p.Glu280Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 16:21:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu280lys' Tue Jun 30 17:00:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu280Lys' Q6VVB1:p.Gln302Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 19:18:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln302pro' Tue Jun 30 15:41:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln302Pro' Q6VVB1:p.Phe33Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F S Wed May 02 20:19:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe33ser' Tue Jun 30 20:13:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe33Ser' 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3D epm2a-nhlrc1-17 3 6 enzyme enzyme neutral component neutral component c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range true n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro translated in vitro translated protein in vitro translated n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 ancillary ancillary neutral component neutral component physical association physical association 5 Human E2 ubuquitin ligase added but not specified