IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Biochemical and biophysical research communications 2005 imex curation Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw Accepted 2016-FEB-11 AT 14:44 GMT AT 14:44 GMT by PPORRAS Biochemical and biophysical research communications 2005 Only protein-protein interactions imex curation imex curation Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Biochemical and biophysical research communications 2005 imex curation Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw Accepted 2016-FEB-11 AT 14:44 GMT AT 14:44 GMT by PPORRAS Biochemical and biophysical research communications 2005 Only protein-protein interactions imex curation imex curation Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Biochemical and biophysical research communications 2005 imex curation Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw Accepted 2016-FEB-11 AT 14:44 GMT AT 14:44 GMT by PPORRAS Human testis cDNA Biochemical and biophysical research communications 2005 Only protein-protein interactions imex curation imex curation Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Characterization of two non-testis-specific CABYR variants that bind to GSK3beta with a proline-rich extensin-like domain. Biochemical and biophysical research communications 2005 imex curation Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR., Hsu HC., Lee YL., Cheng TS., Howng SL., Chang LK., Lu PJ., Hong YR. m835016@cc.kmu.edu.tw Accepted 2016-FEB-11 AT 14:44 GMT AT 14:44 GMT by PPORRAS Biochemical and biophysical research communications 2005 Only protein-protein interactions imex curation imex curation gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 o75952-3 Calcium-binding tyrosine phosphorylation-regulated protein CABYR CBP86 FSP2 Calcium-binding protein 86 Cancer/testis antigen 88 Fibrousheathin II Fibrousheathin-2 Testis-specific calcium-binding protein CBP86 CBP86-II protein protein human Homo sapiens Human MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN 9E6748129EEE16E4 o75952-5 Calcium-binding tyrosine phosphorylation-regulated protein Calcium-binding protein 86 Cancer/testis antigen 88 Fibrousheathin II Fibrousheathin-2 Testis-specific calcium-binding protein CBP86 CBP86-III CABYR CBP86 FSP2 protein protein human Homo sapiens Human MEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN 93966975E7AAFF08 cabyr_human Calcium-binding tyrosine phosphorylation-regulated protein CABYR CBP86 FSP2 Calcium-binding protein 86 Cancer/testis antigen 88 Fibrousheathin II Fibrousheathin-2 Testis-specific calcium-binding protein CBP86 protein protein human Homo sapiens Human MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLEVEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGESTAE 42F97605262C8199 cabyr-gsk3b-1 3 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association Body text, fig 1A gsk3b-cabyr-1 4 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 3A gsk3b-cabyr-2 4 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association Fig. 3A Full length CABYR 379 does not interact, which the authors suggest may be due to its conformation. cabyr-cabyr-1 4 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 24 22 physical association physical association Fig. 3A Full length CABYR 379 does not interact, which the authors suggest may be due to its conformation. gsk3b-cabyr-4 2 7 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4C gsk3b-cabyr-5 2 6 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4C gsk3b-cabyr-7 1 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O75952-3:p.Thr151Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:15:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr151ala' Tue Jun 30 16:42:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr151Ala' O75952-3:p.Ser155Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:27:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser155ala' Tue Jun 30 18:53:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser155Ala' O75952-3:p.[Thr151Ala;Ser155Ala] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:44:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr151ala,ser155ala' Tue Jun 30 18:54:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr151Ala;Ser155Ala]' region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 5 cabyr-gsk3b-2 1 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 5